Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3AEV8

Protein Details
Accession A0A2T3AEV8    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
39-59RIMWRWPGKKQGKKRSRAFVTHydrophilic
NLS Segment(s)
PositionSequence
46-54GKKQGKKRS
Subcellular Location(s) mito 19, cyto 4.5, cyto_pero 3, nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSYLLRDLQRYRISCYFIPRFGYDPIHLVYGIIHSVILRIMWRWPGKKQGKKRSRAFVTLCGVGTWLDALLGWCRVLIVCARV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.51
3 0.47
4 0.43
5 0.45
6 0.39
7 0.38
8 0.36
9 0.37
10 0.29
11 0.26
12 0.24
13 0.21
14 0.19
15 0.16
16 0.13
17 0.1
18 0.09
19 0.06
20 0.05
21 0.04
22 0.04
23 0.04
24 0.04
25 0.04
26 0.04
27 0.05
28 0.1
29 0.14
30 0.16
31 0.18
32 0.28
33 0.38
34 0.47
35 0.56
36 0.62
37 0.69
38 0.76
39 0.82
40 0.82
41 0.78
42 0.77
43 0.7
44 0.66
45 0.61
46 0.54
47 0.46
48 0.35
49 0.31
50 0.23
51 0.19
52 0.12
53 0.07
54 0.05
55 0.04
56 0.06
57 0.07
58 0.08
59 0.08
60 0.07
61 0.08
62 0.08
63 0.09