Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3A5I1

Protein Details
Accession A0A2T3A5I1    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
22-50TKYPRQAQWRAPKRGPRRRLDRRTHGSLQHydrophilic
NLS Segment(s)
PositionSequence
31-43RAPKRGPRRRLDR
Subcellular Location(s) mito 14, nucl 5, extr 5, cyto 2
Family & Domain DBs
Amino Acid Sequences MQARMLASLSHATVASSRQSLTKYPRQAQWRAPKRGPRRRLDRRTHGSLQGIFLAAAPSHSRCALLYSSWLWLWRWRWCPRRPGPSLAQAARIVARWCLLWDSQSTLDSVLERGERGGSGDPWDVWVLARRPGSGRPRGLVADGPRSHMC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.13
4 0.14
5 0.15
6 0.18
7 0.23
8 0.3
9 0.37
10 0.43
11 0.47
12 0.54
13 0.59
14 0.63
15 0.67
16 0.7
17 0.71
18 0.71
19 0.73
20 0.76
21 0.79
22 0.84
23 0.83
24 0.82
25 0.83
26 0.85
27 0.89
28 0.89
29 0.88
30 0.86
31 0.85
32 0.79
33 0.72
34 0.65
35 0.56
36 0.46
37 0.36
38 0.29
39 0.2
40 0.16
41 0.12
42 0.08
43 0.07
44 0.07
45 0.07
46 0.08
47 0.08
48 0.09
49 0.08
50 0.11
51 0.1
52 0.1
53 0.11
54 0.1
55 0.12
56 0.12
57 0.12
58 0.11
59 0.14
60 0.16
61 0.21
62 0.27
63 0.35
64 0.43
65 0.47
66 0.57
67 0.61
68 0.68
69 0.65
70 0.64
71 0.59
72 0.59
73 0.6
74 0.51
75 0.46
76 0.37
77 0.34
78 0.28
79 0.25
80 0.18
81 0.12
82 0.12
83 0.08
84 0.09
85 0.1
86 0.1
87 0.09
88 0.1
89 0.13
90 0.14
91 0.14
92 0.14
93 0.13
94 0.13
95 0.12
96 0.12
97 0.1
98 0.09
99 0.09
100 0.09
101 0.09
102 0.08
103 0.1
104 0.12
105 0.11
106 0.14
107 0.15
108 0.14
109 0.16
110 0.16
111 0.14
112 0.13
113 0.18
114 0.17
115 0.21
116 0.23
117 0.22
118 0.24
119 0.33
120 0.41
121 0.43
122 0.45
123 0.42
124 0.44
125 0.44
126 0.44
127 0.42
128 0.38
129 0.4
130 0.36