Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2ZZ48

Protein Details
Accession A0A2T2ZZ48    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
26-55RLEYVSTGKNKQKKNKKKRAWACTASQRRCHydrophilic
NLS Segment(s)
PositionSequence
34-44KNKQKKNKKKR
Subcellular Location(s) nucl 15, cyto 7, mito 4
Family & Domain DBs
Amino Acid Sequences MLVESFVNMFRTFETFELVLPTCRVRLEYVSTGKNKQKKNKKKRAWACTASQRRCCRLQLSHTAYMFVYSHNHALAAFHPASCTLVSLFCWSSVGRRWGSWVSCCSNPWSLVLSSSYEAEAVNGRQKTREGRIQIHRAIIFPAGRDCHTKRRRSGLCIRGASILHGEDLTSTSCLRLGLQTVRERPEAKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.16
4 0.2
5 0.2
6 0.19
7 0.18
8 0.19
9 0.16
10 0.16
11 0.17
12 0.15
13 0.18
14 0.23
15 0.28
16 0.33
17 0.38
18 0.42
19 0.47
20 0.53
21 0.57
22 0.59
23 0.62
24 0.68
25 0.73
26 0.8
27 0.85
28 0.87
29 0.91
30 0.93
31 0.93
32 0.92
33 0.86
34 0.83
35 0.82
36 0.83
37 0.79
38 0.78
39 0.74
40 0.68
41 0.67
42 0.61
43 0.57
44 0.52
45 0.51
46 0.53
47 0.54
48 0.56
49 0.51
50 0.49
51 0.43
52 0.38
53 0.31
54 0.21
55 0.16
56 0.11
57 0.12
58 0.11
59 0.11
60 0.09
61 0.1
62 0.09
63 0.12
64 0.11
65 0.1
66 0.1
67 0.1
68 0.11
69 0.1
70 0.1
71 0.06
72 0.06
73 0.06
74 0.08
75 0.08
76 0.07
77 0.08
78 0.08
79 0.09
80 0.13
81 0.16
82 0.15
83 0.14
84 0.17
85 0.2
86 0.21
87 0.22
88 0.22
89 0.21
90 0.22
91 0.22
92 0.22
93 0.22
94 0.21
95 0.19
96 0.18
97 0.14
98 0.14
99 0.15
100 0.13
101 0.12
102 0.12
103 0.11
104 0.08
105 0.08
106 0.08
107 0.08
108 0.08
109 0.13
110 0.14
111 0.15
112 0.16
113 0.18
114 0.23
115 0.27
116 0.33
117 0.32
118 0.39
119 0.47
120 0.53
121 0.54
122 0.54
123 0.48
124 0.42
125 0.38
126 0.33
127 0.25
128 0.19
129 0.2
130 0.17
131 0.18
132 0.24
133 0.26
134 0.34
135 0.42
136 0.49
137 0.52
138 0.61
139 0.65
140 0.67
141 0.74
142 0.71
143 0.72
144 0.67
145 0.62
146 0.55
147 0.5
148 0.43
149 0.35
150 0.26
151 0.18
152 0.15
153 0.13
154 0.1
155 0.11
156 0.11
157 0.1
158 0.09
159 0.09
160 0.1
161 0.11
162 0.11
163 0.12
164 0.15
165 0.2
166 0.27
167 0.35
168 0.39
169 0.43
170 0.47