Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2ZVZ0

Protein Details
Accession A0A2T2ZVZ0    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
15-44SPPVERLKTPTKRGARRRRGKGHVKGKDSEBasic
NLS Segment(s)
PositionSequence
22-41KTPTKRGARRRRGKGHVKGK
Subcellular Location(s) nucl 14, mito 6.5, cyto_mito 5.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MAWAGLASLQWSLSSPPVERLKTPTKRGARRRRGKGHVKGKDSESHDGATDDHGNGDDNNYSCHQGDASGNGNGNGKDNIPSSPPSPPRLPCEEPPMLRSPAYPVSLFPPLPPPPPPRPPTHLELPVRVKSAPEGLGILNWERLEQLDLFRME
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.22
4 0.29
5 0.31
6 0.32
7 0.38
8 0.45
9 0.51
10 0.56
11 0.58
12 0.61
13 0.69
14 0.79
15 0.83
16 0.83
17 0.86
18 0.9
19 0.9
20 0.9
21 0.91
22 0.9
23 0.9
24 0.88
25 0.82
26 0.76
27 0.69
28 0.66
29 0.6
30 0.54
31 0.45
32 0.37
33 0.32
34 0.28
35 0.25
36 0.2
37 0.17
38 0.12
39 0.11
40 0.1
41 0.1
42 0.09
43 0.1
44 0.1
45 0.08
46 0.1
47 0.11
48 0.12
49 0.12
50 0.12
51 0.11
52 0.1
53 0.1
54 0.11
55 0.12
56 0.12
57 0.12
58 0.12
59 0.14
60 0.12
61 0.13
62 0.11
63 0.09
64 0.09
65 0.1
66 0.1
67 0.1
68 0.12
69 0.12
70 0.18
71 0.21
72 0.23
73 0.27
74 0.28
75 0.32
76 0.38
77 0.41
78 0.36
79 0.41
80 0.42
81 0.39
82 0.4
83 0.39
84 0.34
85 0.3
86 0.27
87 0.24
88 0.23
89 0.24
90 0.21
91 0.17
92 0.2
93 0.23
94 0.23
95 0.19
96 0.22
97 0.22
98 0.25
99 0.29
100 0.33
101 0.37
102 0.46
103 0.49
104 0.48
105 0.52
106 0.54
107 0.55
108 0.56
109 0.57
110 0.51
111 0.55
112 0.56
113 0.54
114 0.51
115 0.45
116 0.38
117 0.31
118 0.32
119 0.25
120 0.19
121 0.17
122 0.15
123 0.16
124 0.18
125 0.17
126 0.16
127 0.15
128 0.14
129 0.13
130 0.13
131 0.15
132 0.14
133 0.15