Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3AN20

Protein Details
Accession A0A2T3AN20   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
21-47RTSIRQAHTQTRFRRKKYNLTGFTPGHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, cyto_mito 10.5, cyto 4.5, extr 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR024629  Mhr1  
Gene Ontology GO:0000150  F:DNA strand exchange activity  
GO:0003697  F:single-stranded DNA binding  
GO:0000002  P:mitochondrial genome maintenance  
Pfam View protein in Pfam  
PF12829  Mhr1  
Amino Acid Sequences MNSTPASLVGILDSLAIGVFRTSIRQAHTQTRFRRKKYNLTGFTPGHGENIYIFNHIENGMVIYSHEPILKRDSQKYLSQIPFTVKKQKPPVIRADYWQPLCMIEFGPGQGVVGRNVFQKLREFRTLHELEWGWQADEFKKLNRYERGKRIHDQKPNTVADIAAVLAGAGRGNLMWMSEKQARVLEAAEAAAAKAAAKVAAKEAEEKAAAARAAEAANAVESGKAAPSTTQEQTTQEQATPASVAPETQTTTVAAVKAKSEKPARRLHKATIYWSNDADLYWARDWSDNVEHEVGLPDGIKVWRWQTREIMGHEDEEGPEVMAEENPAENGEQGQEGGDAGKFAEGEAKEAEVVVEPKSDSKKSWLGWLGGRKGGSGSQDVRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.04
5 0.04
6 0.05
7 0.05
8 0.09
9 0.11
10 0.15
11 0.19
12 0.26
13 0.32
14 0.41
15 0.5
16 0.56
17 0.64
18 0.72
19 0.78
20 0.77
21 0.82
22 0.8
23 0.81
24 0.84
25 0.85
26 0.81
27 0.77
28 0.8
29 0.71
30 0.65
31 0.57
32 0.46
33 0.37
34 0.3
35 0.24
36 0.17
37 0.18
38 0.17
39 0.15
40 0.15
41 0.13
42 0.14
43 0.14
44 0.12
45 0.09
46 0.09
47 0.08
48 0.08
49 0.08
50 0.08
51 0.09
52 0.1
53 0.12
54 0.12
55 0.14
56 0.2
57 0.27
58 0.31
59 0.36
60 0.41
61 0.43
62 0.47
63 0.51
64 0.54
65 0.51
66 0.47
67 0.44
68 0.43
69 0.46
70 0.45
71 0.51
72 0.44
73 0.49
74 0.57
75 0.61
76 0.64
77 0.63
78 0.69
79 0.67
80 0.65
81 0.6
82 0.59
83 0.6
84 0.53
85 0.48
86 0.38
87 0.3
88 0.28
89 0.25
90 0.17
91 0.12
92 0.11
93 0.1
94 0.1
95 0.1
96 0.09
97 0.1
98 0.1
99 0.09
100 0.09
101 0.1
102 0.11
103 0.14
104 0.15
105 0.15
106 0.22
107 0.26
108 0.31
109 0.37
110 0.37
111 0.36
112 0.45
113 0.45
114 0.37
115 0.37
116 0.32
117 0.25
118 0.29
119 0.28
120 0.18
121 0.18
122 0.19
123 0.15
124 0.2
125 0.19
126 0.17
127 0.24
128 0.26
129 0.32
130 0.39
131 0.46
132 0.5
133 0.58
134 0.64
135 0.63
136 0.67
137 0.7
138 0.7
139 0.71
140 0.67
141 0.65
142 0.64
143 0.59
144 0.54
145 0.44
146 0.35
147 0.27
148 0.22
149 0.14
150 0.06
151 0.05
152 0.03
153 0.03
154 0.03
155 0.03
156 0.02
157 0.02
158 0.02
159 0.02
160 0.03
161 0.03
162 0.05
163 0.05
164 0.1
165 0.14
166 0.14
167 0.15
168 0.16
169 0.16
170 0.15
171 0.15
172 0.11
173 0.07
174 0.07
175 0.06
176 0.05
177 0.05
178 0.04
179 0.03
180 0.03
181 0.03
182 0.03
183 0.04
184 0.04
185 0.04
186 0.06
187 0.08
188 0.08
189 0.11
190 0.11
191 0.12
192 0.11
193 0.11
194 0.1
195 0.1
196 0.1
197 0.07
198 0.07
199 0.06
200 0.06
201 0.06
202 0.06
203 0.04
204 0.05
205 0.05
206 0.05
207 0.04
208 0.04
209 0.04
210 0.04
211 0.04
212 0.04
213 0.05
214 0.07
215 0.12
216 0.13
217 0.15
218 0.16
219 0.18
220 0.2
221 0.23
222 0.21
223 0.17
224 0.17
225 0.15
226 0.14
227 0.12
228 0.11
229 0.09
230 0.08
231 0.07
232 0.07
233 0.09
234 0.1
235 0.09
236 0.1
237 0.09
238 0.1
239 0.11
240 0.11
241 0.11
242 0.1
243 0.12
244 0.17
245 0.18
246 0.24
247 0.32
248 0.36
249 0.43
250 0.52
251 0.57
252 0.6
253 0.63
254 0.62
255 0.63
256 0.6
257 0.59
258 0.59
259 0.57
260 0.5
261 0.46
262 0.41
263 0.32
264 0.28
265 0.24
266 0.16
267 0.15
268 0.14
269 0.14
270 0.14
271 0.15
272 0.16
273 0.18
274 0.22
275 0.19
276 0.22
277 0.22
278 0.21
279 0.2
280 0.21
281 0.16
282 0.11
283 0.1
284 0.07
285 0.09
286 0.09
287 0.1
288 0.11
289 0.17
290 0.22
291 0.25
292 0.29
293 0.31
294 0.37
295 0.42
296 0.43
297 0.44
298 0.39
299 0.37
300 0.35
301 0.31
302 0.24
303 0.2
304 0.18
305 0.11
306 0.1
307 0.09
308 0.09
309 0.08
310 0.08
311 0.07
312 0.07
313 0.07
314 0.08
315 0.08
316 0.07
317 0.08
318 0.08
319 0.08
320 0.08
321 0.08
322 0.07
323 0.07
324 0.08
325 0.07
326 0.06
327 0.06
328 0.07
329 0.07
330 0.06
331 0.13
332 0.12
333 0.14
334 0.15
335 0.15
336 0.14
337 0.15
338 0.15
339 0.12
340 0.13
341 0.11
342 0.12
343 0.12
344 0.18
345 0.23
346 0.25
347 0.24
348 0.3
349 0.36
350 0.36
351 0.44
352 0.45
353 0.43
354 0.48
355 0.55
356 0.53
357 0.5
358 0.49
359 0.41
360 0.37
361 0.36
362 0.32
363 0.3