Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3A5E2

Protein Details
Accession A0A2T3A5E2   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
185-216TVNAERERNKERSKKLQKNCSRLLPQRERKERHydrophilic
NLS Segment(s)
PositionSequence
196-198RSK
Subcellular Location(s) mito 12, nucl 7, cyto_nucl 7, cyto 5
Family & Domain DBs
Amino Acid Sequences MINVKRAALPLPFPTISYSLLRLPHLPIGERTHHKQYESVPSLGSSEVLRRLSPGGHIRACRTPQRVDLEIVKLSNLFDFFIVDVFIVTTCYAMPHPPSLGFGDRIQRQGQRVILPDSPFPKIDTQNKNAIKRLVTKSPPPLNNRLHHDFPSPVPFQKPTLRIPGHESDRVKRPVTRFLPYNAGTVNAERERNKERSKKLQKNCSRLLPQRERKER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.28
4 0.26
5 0.25
6 0.22
7 0.25
8 0.26
9 0.24
10 0.25
11 0.26
12 0.26
13 0.25
14 0.26
15 0.29
16 0.35
17 0.4
18 0.43
19 0.48
20 0.49
21 0.48
22 0.47
23 0.47
24 0.5
25 0.48
26 0.43
27 0.34
28 0.32
29 0.32
30 0.29
31 0.24
32 0.14
33 0.12
34 0.16
35 0.16
36 0.16
37 0.16
38 0.17
39 0.16
40 0.21
41 0.25
42 0.26
43 0.29
44 0.31
45 0.34
46 0.39
47 0.43
48 0.44
49 0.42
50 0.39
51 0.41
52 0.45
53 0.44
54 0.4
55 0.4
56 0.36
57 0.33
58 0.3
59 0.24
60 0.18
61 0.16
62 0.14
63 0.11
64 0.08
65 0.06
66 0.06
67 0.06
68 0.06
69 0.06
70 0.05
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.05
79 0.05
80 0.06
81 0.07
82 0.08
83 0.09
84 0.09
85 0.1
86 0.11
87 0.13
88 0.13
89 0.14
90 0.18
91 0.19
92 0.21
93 0.22
94 0.22
95 0.22
96 0.23
97 0.23
98 0.2
99 0.21
100 0.22
101 0.23
102 0.22
103 0.23
104 0.22
105 0.22
106 0.2
107 0.19
108 0.19
109 0.22
110 0.3
111 0.34
112 0.36
113 0.44
114 0.5
115 0.51
116 0.51
117 0.48
118 0.41
119 0.42
120 0.43
121 0.42
122 0.39
123 0.41
124 0.47
125 0.53
126 0.57
127 0.54
128 0.58
129 0.57
130 0.59
131 0.62
132 0.59
133 0.54
134 0.5
135 0.48
136 0.41
137 0.37
138 0.37
139 0.32
140 0.27
141 0.27
142 0.27
143 0.28
144 0.33
145 0.34
146 0.32
147 0.39
148 0.39
149 0.38
150 0.43
151 0.46
152 0.45
153 0.48
154 0.48
155 0.43
156 0.5
157 0.54
158 0.5
159 0.47
160 0.45
161 0.49
162 0.5
163 0.51
164 0.46
165 0.45
166 0.5
167 0.46
168 0.45
169 0.35
170 0.33
171 0.28
172 0.25
173 0.29
174 0.24
175 0.28
176 0.27
177 0.32
178 0.37
179 0.44
180 0.53
181 0.55
182 0.6
183 0.67
184 0.77
185 0.82
186 0.85
187 0.88
188 0.88
189 0.89
190 0.88
191 0.87
192 0.85
193 0.84
194 0.84
195 0.84
196 0.85