Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3AAQ1

Protein Details
Accession A0A2T3AAQ1    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
78-109VYSSIKKRCEHCKVVRRKKNKRSNGYRYIICSHydrophilic
NLS Segment(s)
PositionSequence
94-98RKKNK
Subcellular Location(s) mito 17, nucl 9.5, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences MASQQCIARCTRTASSLLGLSSSLRALSLSATPVARPAIQTRALSSAILPLASYSPLSRALSRHTTPLAQQQTRGMKVYSSIKKRCEHCKVVRRKKNKRSNGYRYIICSANPRHKQRQGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.27
4 0.24
5 0.19
6 0.16
7 0.14
8 0.13
9 0.11
10 0.08
11 0.07
12 0.07
13 0.06
14 0.07
15 0.08
16 0.08
17 0.1
18 0.1
19 0.1
20 0.12
21 0.13
22 0.12
23 0.12
24 0.13
25 0.16
26 0.19
27 0.2
28 0.2
29 0.22
30 0.22
31 0.2
32 0.18
33 0.15
34 0.12
35 0.11
36 0.09
37 0.07
38 0.06
39 0.07
40 0.07
41 0.05
42 0.06
43 0.09
44 0.1
45 0.11
46 0.11
47 0.15
48 0.21
49 0.21
50 0.22
51 0.2
52 0.2
53 0.21
54 0.28
55 0.32
56 0.27
57 0.27
58 0.31
59 0.34
60 0.35
61 0.35
62 0.27
63 0.19
64 0.23
65 0.31
66 0.33
67 0.37
68 0.41
69 0.45
70 0.52
71 0.57
72 0.63
73 0.63
74 0.65
75 0.66
76 0.71
77 0.76
78 0.82
79 0.86
80 0.87
81 0.9
82 0.91
83 0.92
84 0.92
85 0.92
86 0.92
87 0.92
88 0.91
89 0.87
90 0.8
91 0.75
92 0.68
93 0.59
94 0.49
95 0.48
96 0.45
97 0.49
98 0.54
99 0.57
100 0.64