Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2ZY87

Protein Details
Accession A0A2T2ZY87    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MLRPPQRVLRRAIRRRRPVFLLLHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, plas 7, mito 4, golg 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR021047  Mannosyltransferase_CMT1  
Gene Ontology GO:0016757  F:glycosyltransferase activity  
Pfam View protein in Pfam  
PF11735  CAP59_mtransfer  
Amino Acid Sequences MLRPPQRVLRRAIRRRRPVFLLLLAILILDAIALANRRPRARRVPIGASKQANTTVFIASVHRNTGRILPDWSVATLALVQYLGADNVYFSAVESGSQDDTKEKLAALKEQLDARGVPNTISLGMTVWEQLDEMWTRPDPAASRVPGWIWNEEDKLYDLRRISYLAKERNRAMEPMRVLEGQGITFHKLLWINDIMFNVEDFVTLLHTNDGNYASACSMDFKYPSTYYDTFALRDEDGHKTSSSYWPWFRSPASRDAVLHSDPVPVQSCWNGMVLFDAKPFYGDKALRFRAISDSLADYHLEASECCLIHADNPLTTVPDQGVWLNPNVRVGYSLATYESVQAKHGSAFPNVPTAVLSAWVNRWVQWKGILQQHFESTTVLKRVSQWSQAEPYGQRSEPGLACLVNEKQIMWMNGWKHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.86
3 0.85
4 0.81
5 0.76
6 0.72
7 0.65
8 0.58
9 0.48
10 0.41
11 0.33
12 0.26
13 0.19
14 0.13
15 0.08
16 0.03
17 0.03
18 0.02
19 0.04
20 0.05
21 0.07
22 0.13
23 0.19
24 0.25
25 0.3
26 0.38
27 0.48
28 0.56
29 0.64
30 0.66
31 0.71
32 0.75
33 0.79
34 0.79
35 0.72
36 0.64
37 0.57
38 0.54
39 0.45
40 0.38
41 0.31
42 0.24
43 0.2
44 0.19
45 0.2
46 0.19
47 0.2
48 0.22
49 0.21
50 0.21
51 0.22
52 0.27
53 0.27
54 0.26
55 0.27
56 0.24
57 0.26
58 0.26
59 0.25
60 0.2
61 0.16
62 0.14
63 0.12
64 0.1
65 0.08
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.05
72 0.05
73 0.04
74 0.05
75 0.06
76 0.05
77 0.05
78 0.06
79 0.06
80 0.07
81 0.08
82 0.09
83 0.1
84 0.11
85 0.11
86 0.11
87 0.13
88 0.14
89 0.14
90 0.12
91 0.15
92 0.16
93 0.21
94 0.23
95 0.25
96 0.25
97 0.27
98 0.27
99 0.24
100 0.23
101 0.2
102 0.2
103 0.17
104 0.14
105 0.13
106 0.13
107 0.12
108 0.11
109 0.1
110 0.07
111 0.07
112 0.07
113 0.07
114 0.06
115 0.06
116 0.06
117 0.05
118 0.07
119 0.08
120 0.08
121 0.1
122 0.11
123 0.12
124 0.12
125 0.14
126 0.13
127 0.17
128 0.21
129 0.2
130 0.21
131 0.21
132 0.22
133 0.24
134 0.25
135 0.23
136 0.2
137 0.21
138 0.21
139 0.2
140 0.2
141 0.17
142 0.18
143 0.17
144 0.18
145 0.16
146 0.16
147 0.16
148 0.18
149 0.18
150 0.22
151 0.29
152 0.34
153 0.38
154 0.41
155 0.42
156 0.45
157 0.45
158 0.41
159 0.36
160 0.32
161 0.29
162 0.27
163 0.27
164 0.21
165 0.2
166 0.18
167 0.16
168 0.11
169 0.11
170 0.11
171 0.1
172 0.1
173 0.1
174 0.11
175 0.12
176 0.12
177 0.13
178 0.14
179 0.13
180 0.14
181 0.15
182 0.13
183 0.11
184 0.11
185 0.09
186 0.07
187 0.06
188 0.05
189 0.04
190 0.05
191 0.05
192 0.05
193 0.05
194 0.06
195 0.06
196 0.07
197 0.08
198 0.07
199 0.07
200 0.07
201 0.06
202 0.06
203 0.06
204 0.07
205 0.07
206 0.08
207 0.08
208 0.09
209 0.12
210 0.13
211 0.14
212 0.19
213 0.19
214 0.19
215 0.22
216 0.22
217 0.19
218 0.2
219 0.2
220 0.14
221 0.14
222 0.15
223 0.16
224 0.16
225 0.17
226 0.16
227 0.15
228 0.17
229 0.21
230 0.21
231 0.23
232 0.25
233 0.27
234 0.28
235 0.3
236 0.3
237 0.31
238 0.31
239 0.33
240 0.33
241 0.31
242 0.31
243 0.31
244 0.33
245 0.27
246 0.25
247 0.19
248 0.17
249 0.15
250 0.17
251 0.16
252 0.13
253 0.13
254 0.13
255 0.13
256 0.12
257 0.13
258 0.11
259 0.08
260 0.1
261 0.11
262 0.1
263 0.11
264 0.1
265 0.09
266 0.1
267 0.11
268 0.1
269 0.14
270 0.15
271 0.19
272 0.27
273 0.3
274 0.31
275 0.3
276 0.3
277 0.29
278 0.3
279 0.27
280 0.2
281 0.19
282 0.18
283 0.19
284 0.18
285 0.13
286 0.11
287 0.11
288 0.1
289 0.08
290 0.09
291 0.12
292 0.12
293 0.11
294 0.12
295 0.11
296 0.12
297 0.18
298 0.17
299 0.14
300 0.15
301 0.16
302 0.17
303 0.17
304 0.17
305 0.11
306 0.1
307 0.11
308 0.1
309 0.13
310 0.12
311 0.15
312 0.16
313 0.16
314 0.19
315 0.18
316 0.18
317 0.16
318 0.16
319 0.15
320 0.13
321 0.13
322 0.11
323 0.12
324 0.13
325 0.15
326 0.18
327 0.16
328 0.17
329 0.18
330 0.18
331 0.18
332 0.22
333 0.21
334 0.19
335 0.22
336 0.21
337 0.25
338 0.24
339 0.22
340 0.19
341 0.17
342 0.15
343 0.14
344 0.14
345 0.11
346 0.12
347 0.16
348 0.16
349 0.18
350 0.23
351 0.23
352 0.24
353 0.27
354 0.32
355 0.34
356 0.42
357 0.43
358 0.41
359 0.43
360 0.45
361 0.4
362 0.36
363 0.31
364 0.25
365 0.27
366 0.27
367 0.25
368 0.23
369 0.26
370 0.32
371 0.36
372 0.41
373 0.39
374 0.41
375 0.46
376 0.46
377 0.48
378 0.43
379 0.45
380 0.43
381 0.39
382 0.35
383 0.31
384 0.35
385 0.3
386 0.3
387 0.26
388 0.2
389 0.2
390 0.24
391 0.24
392 0.23
393 0.22
394 0.2
395 0.22
396 0.28
397 0.29
398 0.27
399 0.31