Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q7S683

Protein Details
Accession Q7S683    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
515-539KESEAKDRARRERWLRNVKEGKPNVBasic
NLS Segment(s)
PositionSequence
502-537RSKERKKEALRVWKESEAKDRARRERWLRNVKEGKP
Subcellular Location(s) plas 11, mito 5, E.R. 3, cyto_mito 3, nucl 2, extr 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001128  Cyt_P450  
IPR017972  Cyt_P450_CS  
IPR002401  Cyt_P450_E_grp-I  
IPR036396  Cyt_P450_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0020037  F:heme binding  
GO:0005506  F:iron ion binding  
GO:0004497  F:monooxygenase activity  
GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
GO:0017000  P:antibiotic biosynthetic process  
KEGG ncr:NCU07092  -  
Pfam View protein in Pfam  
PF00067  p450  
PROSITE View protein in PROSITE  
PS00086  CYTOCHROME_P450  
Amino Acid Sequences MQLLTLVIVGLFMLIVAVVHFIKAFREVNDPNGIPGPTQIPYLGRVHDLPIQFMWLKFKEWADKYGQQGFYRTMMLGAEFIVVTDEKVAEDLLVKRAKYNSDRPVIQSLFDSKSTHGSMEYLPLMGHNTYWARQRKLSHSYLTEATKAHYYGVMYFEVQRWMARLLENPEDFQHSIEDMSSKVMCQLTWDDPSLSEYCTKSAWGLLTQMSPAGPITNVLTPLWHLPTLINPWKRAERKRHDEQQAWWMERLLTCREKLARGELRPCWTRQFLEKTSQKTSISGDYEASCVIGMLALVGIFTVVGPMSYWLVSMVHNPKWQEAVQREVDEVCGNRMPRLEDAPRLPILRACIKETMRWKPNVPTGVAHETEADDHYQGYFIPKGTRILPFDWSFLRNPVKYPDPENFRPERWLEPGWPTYKEPLTQYPTIKGLTSFGWGQRQCLGMSLTQDELIVGCGALAWLFNLRHKRDPITGRELPVPLDRSNSLLIIKPDPFQMEFEPRSKERKKEALRVWKESEAKDRARRERWLRNVKEGKPNVIKEPKVLQPTVKIPSPSPAAAVPAALVDGGEVRDELSKTVQVVKEKSGGVNGHGDSLAEKAVMDVKKKADISITIARLDSTACVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.02
3 0.03
4 0.05
5 0.05
6 0.05
7 0.06
8 0.07
9 0.08
10 0.14
11 0.16
12 0.16
13 0.24
14 0.26
15 0.31
16 0.38
17 0.37
18 0.35
19 0.37
20 0.35
21 0.27
22 0.27
23 0.25
24 0.18
25 0.19
26 0.18
27 0.15
28 0.19
29 0.22
30 0.21
31 0.21
32 0.21
33 0.23
34 0.27
35 0.26
36 0.25
37 0.22
38 0.25
39 0.24
40 0.24
41 0.28
42 0.24
43 0.26
44 0.27
45 0.31
46 0.35
47 0.36
48 0.4
49 0.41
50 0.45
51 0.48
52 0.53
53 0.54
54 0.46
55 0.47
56 0.45
57 0.39
58 0.35
59 0.29
60 0.21
61 0.16
62 0.15
63 0.13
64 0.1
65 0.09
66 0.07
67 0.07
68 0.08
69 0.07
70 0.07
71 0.08
72 0.08
73 0.07
74 0.07
75 0.07
76 0.06
77 0.1
78 0.12
79 0.18
80 0.21
81 0.21
82 0.24
83 0.28
84 0.34
85 0.38
86 0.45
87 0.47
88 0.51
89 0.53
90 0.54
91 0.59
92 0.53
93 0.47
94 0.4
95 0.37
96 0.32
97 0.32
98 0.3
99 0.22
100 0.27
101 0.27
102 0.24
103 0.2
104 0.18
105 0.17
106 0.2
107 0.19
108 0.14
109 0.13
110 0.13
111 0.14
112 0.13
113 0.12
114 0.11
115 0.13
116 0.15
117 0.24
118 0.31
119 0.32
120 0.37
121 0.43
122 0.47
123 0.53
124 0.55
125 0.53
126 0.49
127 0.49
128 0.48
129 0.45
130 0.4
131 0.32
132 0.29
133 0.25
134 0.23
135 0.2
136 0.16
137 0.14
138 0.14
139 0.16
140 0.15
141 0.13
142 0.14
143 0.15
144 0.16
145 0.15
146 0.14
147 0.13
148 0.14
149 0.14
150 0.14
151 0.17
152 0.19
153 0.26
154 0.26
155 0.26
156 0.25
157 0.28
158 0.27
159 0.24
160 0.2
161 0.14
162 0.13
163 0.12
164 0.12
165 0.08
166 0.1
167 0.09
168 0.08
169 0.11
170 0.11
171 0.1
172 0.12
173 0.16
174 0.17
175 0.19
176 0.21
177 0.18
178 0.18
179 0.21
180 0.2
181 0.17
182 0.17
183 0.15
184 0.15
185 0.15
186 0.15
187 0.12
188 0.13
189 0.13
190 0.1
191 0.12
192 0.12
193 0.12
194 0.12
195 0.12
196 0.1
197 0.09
198 0.08
199 0.07
200 0.05
201 0.06
202 0.07
203 0.08
204 0.09
205 0.09
206 0.09
207 0.09
208 0.11
209 0.12
210 0.11
211 0.1
212 0.09
213 0.12
214 0.19
215 0.26
216 0.27
217 0.27
218 0.3
219 0.39
220 0.46
221 0.51
222 0.55
223 0.57
224 0.63
225 0.71
226 0.77
227 0.77
228 0.74
229 0.68
230 0.67
231 0.63
232 0.56
233 0.47
234 0.38
235 0.31
236 0.28
237 0.28
238 0.24
239 0.2
240 0.18
241 0.21
242 0.22
243 0.24
244 0.24
245 0.29
246 0.3
247 0.31
248 0.36
249 0.36
250 0.4
251 0.4
252 0.41
253 0.36
254 0.33
255 0.31
256 0.32
257 0.36
258 0.33
259 0.4
260 0.43
261 0.44
262 0.45
263 0.48
264 0.42
265 0.35
266 0.34
267 0.3
268 0.27
269 0.22
270 0.2
271 0.16
272 0.16
273 0.15
274 0.13
275 0.08
276 0.06
277 0.05
278 0.04
279 0.03
280 0.02
281 0.02
282 0.02
283 0.02
284 0.02
285 0.02
286 0.02
287 0.02
288 0.02
289 0.02
290 0.02
291 0.02
292 0.03
293 0.03
294 0.04
295 0.04
296 0.04
297 0.05
298 0.05
299 0.1
300 0.13
301 0.16
302 0.18
303 0.18
304 0.19
305 0.21
306 0.21
307 0.22
308 0.2
309 0.23
310 0.23
311 0.23
312 0.23
313 0.2
314 0.2
315 0.16
316 0.14
317 0.11
318 0.11
319 0.1
320 0.11
321 0.12
322 0.13
323 0.13
324 0.17
325 0.18
326 0.19
327 0.21
328 0.23
329 0.24
330 0.23
331 0.22
332 0.18
333 0.2
334 0.22
335 0.22
336 0.2
337 0.24
338 0.24
339 0.29
340 0.34
341 0.4
342 0.4
343 0.41
344 0.41
345 0.4
346 0.45
347 0.43
348 0.38
349 0.3
350 0.3
351 0.31
352 0.3
353 0.25
354 0.2
355 0.18
356 0.17
357 0.16
358 0.12
359 0.07
360 0.07
361 0.07
362 0.06
363 0.06
364 0.08
365 0.08
366 0.09
367 0.1
368 0.11
369 0.13
370 0.15
371 0.19
372 0.2
373 0.2
374 0.24
375 0.23
376 0.24
377 0.24
378 0.24
379 0.21
380 0.24
381 0.28
382 0.24
383 0.24
384 0.27
385 0.3
386 0.3
387 0.32
388 0.34
389 0.37
390 0.4
391 0.45
392 0.44
393 0.4
394 0.42
395 0.41
396 0.37
397 0.34
398 0.32
399 0.27
400 0.29
401 0.33
402 0.32
403 0.32
404 0.31
405 0.31
406 0.31
407 0.3
408 0.28
409 0.3
410 0.33
411 0.35
412 0.35
413 0.33
414 0.34
415 0.33
416 0.3
417 0.23
418 0.19
419 0.15
420 0.16
421 0.15
422 0.15
423 0.22
424 0.22
425 0.23
426 0.24
427 0.25
428 0.22
429 0.22
430 0.21
431 0.15
432 0.17
433 0.17
434 0.15
435 0.14
436 0.13
437 0.11
438 0.1
439 0.09
440 0.07
441 0.05
442 0.04
443 0.04
444 0.04
445 0.04
446 0.04
447 0.03
448 0.07
449 0.08
450 0.13
451 0.21
452 0.25
453 0.31
454 0.34
455 0.38
456 0.42
457 0.49
458 0.51
459 0.53
460 0.52
461 0.49
462 0.5
463 0.46
464 0.41
465 0.39
466 0.35
467 0.27
468 0.27
469 0.24
470 0.23
471 0.23
472 0.22
473 0.18
474 0.18
475 0.2
476 0.21
477 0.22
478 0.21
479 0.21
480 0.23
481 0.22
482 0.21
483 0.23
484 0.27
485 0.29
486 0.31
487 0.36
488 0.36
489 0.45
490 0.48
491 0.51
492 0.52
493 0.59
494 0.64
495 0.68
496 0.75
497 0.77
498 0.78
499 0.79
500 0.75
501 0.72
502 0.69
503 0.62
504 0.61
505 0.58
506 0.58
507 0.59
508 0.63
509 0.65
510 0.67
511 0.73
512 0.73
513 0.76
514 0.79
515 0.81
516 0.77
517 0.79
518 0.82
519 0.79
520 0.8
521 0.73
522 0.72
523 0.69
524 0.68
525 0.66
526 0.65
527 0.6
528 0.54
529 0.56
530 0.54
531 0.51
532 0.5
533 0.43
534 0.41
535 0.46
536 0.46
537 0.45
538 0.4
539 0.35
540 0.39
541 0.41
542 0.35
543 0.3
544 0.26
545 0.24
546 0.23
547 0.22
548 0.16
549 0.11
550 0.11
551 0.08
552 0.07
553 0.04
554 0.05
555 0.06
556 0.06
557 0.06
558 0.06
559 0.1
560 0.11
561 0.12
562 0.14
563 0.15
564 0.16
565 0.24
566 0.27
567 0.3
568 0.33
569 0.35
570 0.38
571 0.38
572 0.37
573 0.36
574 0.34
575 0.3
576 0.34
577 0.3
578 0.27
579 0.25
580 0.24
581 0.18
582 0.18
583 0.16
584 0.1
585 0.09
586 0.08
587 0.15
588 0.18
589 0.21
590 0.24
591 0.26
592 0.33
593 0.34
594 0.35
595 0.32
596 0.31
597 0.35
598 0.4
599 0.39
600 0.34
601 0.33
602 0.32
603 0.28
604 0.26