Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U9W8K6

Protein Details
Accession U9W8K6    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
41-61EKVERAPKARWRQLTHRRLQTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10.833, cyto_mito 6.833, mito 6.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR027450  AlkB-like  
IPR037151  AlkB-like_sf  
IPR032862  ALKBH6  
IPR005123  Oxoglu/Fe-dep_dioxygenase  
Gene Ontology GO:0005634  C:nucleus  
KEGG ncr:NCU11182  -  
Pfam View protein in Pfam  
PF13532  2OG-FeII_Oxy_2  
PROSITE View protein in PROSITE  
PS51471  FE2OG_OXY  
Amino Acid Sequences MASSQFSLPPSLEASRIAGLPPSAYYIADFISEEEEQKILEKVERAPKARWRQLTHRRLQTWPSDLVKNTLLDGQPLPAWLEEPIISRLLSVPVLPSSSDSSGDEKEKQQQQHIFADSPHGRPNHVLINEYPPNTGIMPHKDGAAYHPVVCTVSLGSSLCLNLYKAKEDGALDSEPVWRILQEPRSLLITTADLYTEYLHGIDPLSADVNMSERTIANWSLLREPSLYQNGENQRGVRVSLTYRDVLKVSKLGSKLGPMFNRRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.19
4 0.17
5 0.15
6 0.14
7 0.14
8 0.13
9 0.14
10 0.13
11 0.13
12 0.13
13 0.12
14 0.12
15 0.12
16 0.12
17 0.09
18 0.12
19 0.12
20 0.13
21 0.13
22 0.12
23 0.12
24 0.13
25 0.14
26 0.11
27 0.13
28 0.15
29 0.2
30 0.3
31 0.36
32 0.39
33 0.43
34 0.51
35 0.59
36 0.65
37 0.67
38 0.65
39 0.69
40 0.76
41 0.81
42 0.81
43 0.8
44 0.75
45 0.71
46 0.69
47 0.65
48 0.58
49 0.54
50 0.48
51 0.42
52 0.39
53 0.38
54 0.36
55 0.29
56 0.25
57 0.23
58 0.19
59 0.17
60 0.17
61 0.15
62 0.13
63 0.13
64 0.13
65 0.09
66 0.09
67 0.08
68 0.09
69 0.08
70 0.1
71 0.11
72 0.11
73 0.11
74 0.11
75 0.11
76 0.11
77 0.1
78 0.08
79 0.08
80 0.07
81 0.08
82 0.08
83 0.09
84 0.1
85 0.11
86 0.12
87 0.12
88 0.14
89 0.16
90 0.18
91 0.19
92 0.18
93 0.25
94 0.3
95 0.3
96 0.34
97 0.36
98 0.37
99 0.39
100 0.4
101 0.33
102 0.27
103 0.33
104 0.29
105 0.27
106 0.27
107 0.23
108 0.21
109 0.21
110 0.23
111 0.21
112 0.19
113 0.19
114 0.16
115 0.23
116 0.25
117 0.25
118 0.23
119 0.17
120 0.17
121 0.16
122 0.17
123 0.13
124 0.14
125 0.16
126 0.16
127 0.16
128 0.16
129 0.16
130 0.16
131 0.18
132 0.15
133 0.13
134 0.12
135 0.12
136 0.12
137 0.12
138 0.1
139 0.06
140 0.05
141 0.05
142 0.06
143 0.06
144 0.06
145 0.06
146 0.06
147 0.06
148 0.07
149 0.1
150 0.11
151 0.12
152 0.12
153 0.13
154 0.14
155 0.14
156 0.15
157 0.14
158 0.13
159 0.12
160 0.12
161 0.13
162 0.12
163 0.13
164 0.11
165 0.08
166 0.1
167 0.15
168 0.19
169 0.2
170 0.21
171 0.21
172 0.24
173 0.24
174 0.22
175 0.18
176 0.14
177 0.12
178 0.11
179 0.1
180 0.08
181 0.08
182 0.08
183 0.08
184 0.07
185 0.06
186 0.06
187 0.06
188 0.06
189 0.06
190 0.06
191 0.06
192 0.07
193 0.07
194 0.07
195 0.07
196 0.09
197 0.09
198 0.09
199 0.09
200 0.08
201 0.1
202 0.13
203 0.13
204 0.13
205 0.15
206 0.17
207 0.2
208 0.21
209 0.21
210 0.2
211 0.2
212 0.25
213 0.29
214 0.28
215 0.24
216 0.32
217 0.37
218 0.42
219 0.43
220 0.37
221 0.34
222 0.34
223 0.34
224 0.27
225 0.23
226 0.21
227 0.24
228 0.27
229 0.26
230 0.27
231 0.28
232 0.28
233 0.27
234 0.27
235 0.25
236 0.24
237 0.27
238 0.27
239 0.28
240 0.28
241 0.33
242 0.36
243 0.4
244 0.45