Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2ZX56

Protein Details
Accession A0A2T2ZX56   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
228-248GDDRRRRSRSPSERSARHDQMBasic
NLS Segment(s)
PositionSequence
144-150RKLRRKG
Subcellular Location(s) nucl 14.5, cyto_nucl 13.5, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005037  PRP38  
Gene Ontology GO:0071011  C:precatalytic spliceosome  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF03371  PRP38  
Amino Acid Sequences MAERTHRADERRFLDERGSNISLAPNGLNPATIMEKAVRERIVDSYFFKEQCFAVNEADIVNRVVDHVHFIGGTYGSTQKPTPFLCVAFKLLQLAPRDDILREYLRFGGDKFKYLRALAVFYIRLTRKAKDVYTLLEPYLEDRRKLRRKGRAGTTLTFMDEFVDDLLVKDRVCGTSLWKMPSRDLLEDLDELEPRVSPLGDIEDLLEEDEDQEAAEKENGHGSEDESGDDRRRRSRSPSERSARHDQMEVDREETPESGERSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.48
3 0.43
4 0.42
5 0.39
6 0.33
7 0.32
8 0.32
9 0.25
10 0.22
11 0.2
12 0.13
13 0.14
14 0.13
15 0.13
16 0.11
17 0.12
18 0.13
19 0.13
20 0.13
21 0.13
22 0.17
23 0.19
24 0.23
25 0.22
26 0.21
27 0.22
28 0.25
29 0.26
30 0.25
31 0.26
32 0.27
33 0.31
34 0.3
35 0.29
36 0.26
37 0.23
38 0.25
39 0.26
40 0.22
41 0.19
42 0.19
43 0.19
44 0.18
45 0.18
46 0.14
47 0.11
48 0.09
49 0.07
50 0.07
51 0.07
52 0.07
53 0.09
54 0.09
55 0.09
56 0.08
57 0.09
58 0.1
59 0.09
60 0.09
61 0.07
62 0.1
63 0.1
64 0.12
65 0.13
66 0.13
67 0.17
68 0.18
69 0.21
70 0.19
71 0.21
72 0.22
73 0.23
74 0.26
75 0.23
76 0.22
77 0.2
78 0.19
79 0.21
80 0.2
81 0.2
82 0.17
83 0.18
84 0.18
85 0.16
86 0.16
87 0.15
88 0.16
89 0.15
90 0.15
91 0.15
92 0.15
93 0.15
94 0.15
95 0.2
96 0.18
97 0.22
98 0.22
99 0.24
100 0.25
101 0.25
102 0.26
103 0.18
104 0.2
105 0.16
106 0.16
107 0.14
108 0.12
109 0.17
110 0.15
111 0.2
112 0.2
113 0.2
114 0.22
115 0.25
116 0.25
117 0.23
118 0.24
119 0.21
120 0.23
121 0.23
122 0.19
123 0.16
124 0.16
125 0.14
126 0.22
127 0.2
128 0.17
129 0.2
130 0.3
131 0.38
132 0.47
133 0.53
134 0.55
135 0.63
136 0.7
137 0.74
138 0.73
139 0.7
140 0.63
141 0.58
142 0.49
143 0.41
144 0.33
145 0.24
146 0.15
147 0.11
148 0.09
149 0.06
150 0.06
151 0.05
152 0.05
153 0.07
154 0.08
155 0.07
156 0.08
157 0.09
158 0.09
159 0.1
160 0.1
161 0.12
162 0.19
163 0.23
164 0.27
165 0.3
166 0.31
167 0.31
168 0.38
169 0.37
170 0.31
171 0.29
172 0.27
173 0.24
174 0.23
175 0.23
176 0.17
177 0.14
178 0.13
179 0.11
180 0.1
181 0.08
182 0.08
183 0.07
184 0.06
185 0.07
186 0.09
187 0.09
188 0.09
189 0.1
190 0.1
191 0.1
192 0.1
193 0.09
194 0.06
195 0.06
196 0.06
197 0.06
198 0.05
199 0.06
200 0.06
201 0.07
202 0.09
203 0.09
204 0.1
205 0.15
206 0.15
207 0.16
208 0.16
209 0.16
210 0.18
211 0.18
212 0.18
213 0.16
214 0.18
215 0.23
216 0.27
217 0.3
218 0.35
219 0.4
220 0.43
221 0.5
222 0.59
223 0.63
224 0.68
225 0.75
226 0.77
227 0.79
228 0.82
229 0.83
230 0.78
231 0.71
232 0.64
233 0.57
234 0.56
235 0.55
236 0.5
237 0.42
238 0.37
239 0.35
240 0.33
241 0.3
242 0.25
243 0.23