Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2ZSQ9

Protein Details
Accession A0A2T2ZSQ9    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
128-154IEKDTAIREKKNKKTRKQEDKAKAAEEBasic
NLS Segment(s)
PositionSequence
135-150REKKNKKTRKQEDKAK
Subcellular Location(s) mito 18, nucl 4, plas 2, cyto 1, extr 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR035213  DUF5321  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF17254  DUF5321  
Amino Acid Sequences RALSTVPRIAEVSFWKSLVPKFMRRDTTSSQNSQLSKASKTKQSWFAKEWNPATFFVIIFLLIGSMSIQMISLRKNFDAFTRRSDVRIGLLREVVERLQNGQEVDVEKVLGSGDPEKEAAWQEVLDEIEKDTAIREKKNKKTRKQEDKAKAAEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.25
4 0.26
5 0.32
6 0.33
7 0.36
8 0.41
9 0.49
10 0.56
11 0.56
12 0.61
13 0.58
14 0.62
15 0.6
16 0.57
17 0.54
18 0.52
19 0.49
20 0.44
21 0.43
22 0.36
23 0.34
24 0.37
25 0.38
26 0.4
27 0.44
28 0.48
29 0.53
30 0.58
31 0.59
32 0.56
33 0.59
34 0.57
35 0.6
36 0.56
37 0.5
38 0.44
39 0.39
40 0.37
41 0.3
42 0.24
43 0.17
44 0.14
45 0.1
46 0.08
47 0.07
48 0.05
49 0.04
50 0.04
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.04
57 0.05
58 0.06
59 0.08
60 0.09
61 0.1
62 0.11
63 0.11
64 0.15
65 0.2
66 0.2
67 0.22
68 0.26
69 0.27
70 0.27
71 0.28
72 0.24
73 0.22
74 0.25
75 0.23
76 0.18
77 0.19
78 0.18
79 0.18
80 0.18
81 0.15
82 0.11
83 0.1
84 0.11
85 0.11
86 0.12
87 0.12
88 0.11
89 0.13
90 0.12
91 0.13
92 0.11
93 0.1
94 0.08
95 0.08
96 0.08
97 0.07
98 0.07
99 0.08
100 0.09
101 0.1
102 0.1
103 0.1
104 0.12
105 0.14
106 0.13
107 0.11
108 0.11
109 0.1
110 0.12
111 0.12
112 0.12
113 0.1
114 0.1
115 0.1
116 0.1
117 0.09
118 0.09
119 0.15
120 0.18
121 0.25
122 0.34
123 0.44
124 0.55
125 0.65
126 0.74
127 0.78
128 0.86
129 0.9
130 0.92
131 0.92
132 0.93
133 0.93
134 0.92