Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2ZTJ7

Protein Details
Accession A0A2T2ZTJ7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
105-128ERNPWWKGGGRAKHRRRAESRKVEBasic
NLS Segment(s)
PositionSequence
110-127WKGGGRAKHRRRAESRKV
Subcellular Location(s) extr 14, mito 10, plas 2
Family & Domain DBs
Amino Acid Sequences MKVVNFSLLISLTVGGQAGTNLSHFTTYMSVRASAHISIIYICTCALRRGGGFSGPAGWLAGWLAGWGNMGLAGVENITLSPFPLPLPLPLAFLSSLRKVLFPLERNPWWKGGGRAKHRRRAESRKVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.06
3 0.06
4 0.05
5 0.05
6 0.05
7 0.06
8 0.06
9 0.07
10 0.07
11 0.07
12 0.08
13 0.1
14 0.11
15 0.13
16 0.13
17 0.14
18 0.14
19 0.16
20 0.17
21 0.14
22 0.14
23 0.11
24 0.1
25 0.09
26 0.1
27 0.08
28 0.07
29 0.06
30 0.07
31 0.08
32 0.08
33 0.09
34 0.09
35 0.09
36 0.11
37 0.12
38 0.12
39 0.12
40 0.11
41 0.11
42 0.1
43 0.1
44 0.07
45 0.06
46 0.05
47 0.05
48 0.04
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.03
66 0.03
67 0.03
68 0.04
69 0.04
70 0.04
71 0.06
72 0.07
73 0.07
74 0.11
75 0.12
76 0.13
77 0.13
78 0.15
79 0.13
80 0.14
81 0.17
82 0.14
83 0.17
84 0.15
85 0.16
86 0.15
87 0.2
88 0.26
89 0.26
90 0.31
91 0.36
92 0.41
93 0.45
94 0.47
95 0.45
96 0.41
97 0.4
98 0.43
99 0.45
100 0.48
101 0.55
102 0.64
103 0.71
104 0.78
105 0.82
106 0.84
107 0.85
108 0.86