Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2ZSY4

Protein Details
Accession A0A2T2ZSY4    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
149-180TITTMMYHLRRRHKKKERKKGGEYQEKRNLQQHydrophilic
NLS Segment(s)
PositionSequence
158-169RRRHKKKERKKG
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 7
Family & Domain DBs
Amino Acid Sequences MIPSLILFLPDAYCDQQLLPIAMLHLHKTKRTQTSHYVTIISRSDRACSKQRSKINPQPRVCFIADLSERDVMAEACNFSLLQINKENNVSLVMFIQPVSKQIGLILVLFCFSSLSHHPTTKTSKSLVLQGYNKPVPRPERFCFYKYNTITTMMYHLRRRHKKKERKKGGEYQEKRNLQQLVMP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.14
4 0.15
5 0.16
6 0.14
7 0.12
8 0.12
9 0.14
10 0.15
11 0.16
12 0.2
13 0.22
14 0.25
15 0.3
16 0.38
17 0.44
18 0.48
19 0.51
20 0.54
21 0.59
22 0.61
23 0.57
24 0.52
25 0.43
26 0.42
27 0.4
28 0.32
29 0.29
30 0.24
31 0.25
32 0.26
33 0.31
34 0.35
35 0.41
36 0.47
37 0.52
38 0.6
39 0.65
40 0.72
41 0.77
42 0.79
43 0.8
44 0.77
45 0.73
46 0.69
47 0.65
48 0.55
49 0.46
50 0.36
51 0.34
52 0.29
53 0.26
54 0.24
55 0.2
56 0.19
57 0.18
58 0.18
59 0.1
60 0.09
61 0.08
62 0.07
63 0.06
64 0.06
65 0.06
66 0.05
67 0.1
68 0.1
69 0.12
70 0.16
71 0.17
72 0.18
73 0.19
74 0.18
75 0.14
76 0.14
77 0.12
78 0.07
79 0.07
80 0.06
81 0.06
82 0.06
83 0.07
84 0.06
85 0.07
86 0.09
87 0.08
88 0.08
89 0.08
90 0.09
91 0.08
92 0.09
93 0.08
94 0.05
95 0.06
96 0.06
97 0.05
98 0.05
99 0.04
100 0.07
101 0.09
102 0.14
103 0.17
104 0.18
105 0.2
106 0.24
107 0.31
108 0.31
109 0.32
110 0.29
111 0.3
112 0.3
113 0.35
114 0.34
115 0.34
116 0.35
117 0.35
118 0.41
119 0.41
120 0.41
121 0.36
122 0.38
123 0.39
124 0.43
125 0.47
126 0.44
127 0.49
128 0.52
129 0.54
130 0.55
131 0.54
132 0.56
133 0.51
134 0.52
135 0.44
136 0.43
137 0.41
138 0.35
139 0.34
140 0.3
141 0.34
142 0.36
143 0.42
144 0.49
145 0.6
146 0.68
147 0.73
148 0.79
149 0.84
150 0.89
151 0.93
152 0.93
153 0.93
154 0.94
155 0.93
156 0.93
157 0.93
158 0.87
159 0.86
160 0.85
161 0.8
162 0.73
163 0.69
164 0.6