Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3AKC2

Protein Details
Accession A0A2T3AKC2   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
4-30DTSARTYHNRLEKRRQRRSLKDSGDFLHydrophilic
NLS Segment(s)
PositionSequence
95-103ARRKSVRWR
Subcellular Location(s) mito_nucl 10.166, nucl 10, mito 10, cyto_nucl 9.5
Family & Domain DBs
Amino Acid Sequences MPPDTSARTYHNRLEKRRQRRSLKDSGDFLGVQGINPSTGEMDVLTPSTSSAGSPFMALAKAVQEKRTAYEHARSILRSETLRRWEIDKSTLRAARRKSVRWRKAGEGWSSAVEPNLSPIAGSTETPPRGNEFSVDTVIQMPIRPPTRTPSLGRAAGRDGVGRIRSRDREQIGGAHAIALTSVPSNAETGSRIASHNLTTQREFTAAHENDVKLTKPRIRPQGHTPSIQESYSDLIPVNSEFDPQSPSSYHHDAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.76
3 0.79
4 0.85
5 0.88
6 0.88
7 0.9
8 0.9
9 0.89
10 0.88
11 0.84
12 0.77
13 0.69
14 0.61
15 0.5
16 0.42
17 0.37
18 0.28
19 0.21
20 0.19
21 0.17
22 0.13
23 0.13
24 0.14
25 0.08
26 0.08
27 0.08
28 0.06
29 0.07
30 0.07
31 0.08
32 0.08
33 0.07
34 0.07
35 0.08
36 0.08
37 0.07
38 0.07
39 0.08
40 0.08
41 0.08
42 0.09
43 0.09
44 0.09
45 0.08
46 0.08
47 0.1
48 0.16
49 0.18
50 0.19
51 0.21
52 0.22
53 0.25
54 0.28
55 0.27
56 0.25
57 0.29
58 0.31
59 0.32
60 0.33
61 0.31
62 0.29
63 0.28
64 0.26
65 0.22
66 0.24
67 0.26
68 0.29
69 0.31
70 0.3
71 0.31
72 0.31
73 0.32
74 0.35
75 0.34
76 0.31
77 0.36
78 0.39
79 0.39
80 0.42
81 0.43
82 0.44
83 0.45
84 0.49
85 0.54
86 0.61
87 0.66
88 0.69
89 0.7
90 0.66
91 0.68
92 0.66
93 0.58
94 0.49
95 0.42
96 0.35
97 0.32
98 0.26
99 0.19
100 0.13
101 0.1
102 0.08
103 0.07
104 0.06
105 0.05
106 0.05
107 0.07
108 0.07
109 0.08
110 0.08
111 0.13
112 0.15
113 0.15
114 0.16
115 0.16
116 0.16
117 0.16
118 0.15
119 0.13
120 0.13
121 0.14
122 0.14
123 0.11
124 0.11
125 0.11
126 0.1
127 0.08
128 0.07
129 0.11
130 0.14
131 0.14
132 0.14
133 0.19
134 0.24
135 0.28
136 0.3
137 0.31
138 0.34
139 0.38
140 0.37
141 0.34
142 0.31
143 0.29
144 0.26
145 0.21
146 0.16
147 0.15
148 0.17
149 0.17
150 0.18
151 0.22
152 0.27
153 0.3
154 0.36
155 0.36
156 0.35
157 0.35
158 0.35
159 0.31
160 0.28
161 0.24
162 0.17
163 0.15
164 0.11
165 0.1
166 0.07
167 0.05
168 0.04
169 0.04
170 0.04
171 0.05
172 0.05
173 0.06
174 0.07
175 0.07
176 0.08
177 0.1
178 0.1
179 0.11
180 0.12
181 0.13
182 0.14
183 0.19
184 0.24
185 0.26
186 0.26
187 0.27
188 0.26
189 0.26
190 0.25
191 0.22
192 0.28
193 0.24
194 0.26
195 0.29
196 0.28
197 0.29
198 0.31
199 0.3
200 0.24
201 0.3
202 0.34
203 0.39
204 0.47
205 0.55
206 0.59
207 0.63
208 0.69
209 0.73
210 0.71
211 0.66
212 0.61
213 0.57
214 0.55
215 0.49
216 0.39
217 0.29
218 0.28
219 0.24
220 0.22
221 0.15
222 0.12
223 0.13
224 0.13
225 0.15
226 0.12
227 0.13
228 0.13
229 0.14
230 0.18
231 0.18
232 0.21
233 0.19
234 0.23
235 0.28