Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2ZWY2

Protein Details
Accession A0A2T2ZWY2   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
15-42LLWKIPWRLSKFQKRRHRLRLRHVDGVVHydrophilic
77-103KYTIFDRKEKRYRKGIHKLPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
29-30RR
84-96KEKRYRKGIHKLP
Subcellular Location(s) mito 20, mito_nucl 12.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRMTNPLNGGLLWKIPWRLSKFQKRRHRLRLRHVDGVVATLDAALAKAGQTLPAVERWKAEMPTEEEMLPKDKYTIFDRKEKRYRKGIHKLPKWTRVSQRLNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.18
4 0.16
5 0.16
6 0.18
7 0.25
8 0.29
9 0.37
10 0.46
11 0.56
12 0.63
13 0.72
14 0.8
15 0.83
16 0.87
17 0.9
18 0.91
19 0.89
20 0.9
21 0.91
22 0.86
23 0.83
24 0.73
25 0.63
26 0.52
27 0.44
28 0.33
29 0.21
30 0.14
31 0.07
32 0.06
33 0.04
34 0.04
35 0.03
36 0.02
37 0.02
38 0.03
39 0.03
40 0.04
41 0.04
42 0.04
43 0.05
44 0.1
45 0.12
46 0.11
47 0.12
48 0.15
49 0.17
50 0.17
51 0.18
52 0.17
53 0.19
54 0.21
55 0.22
56 0.19
57 0.17
58 0.18
59 0.2
60 0.17
61 0.13
62 0.12
63 0.13
64 0.16
65 0.21
66 0.29
67 0.3
68 0.39
69 0.45
70 0.54
71 0.63
72 0.68
73 0.7
74 0.71
75 0.77
76 0.78
77 0.82
78 0.82
79 0.83
80 0.83
81 0.87
82 0.86
83 0.87
84 0.82
85 0.8
86 0.8
87 0.79
88 0.8
89 0.77
90 0.79