Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3A4H1

Protein Details
Accession A0A2T3A4H1    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
52-72EQVAREMQERKRTKKDKKTKRBasic
NLS Segment(s)
PositionSequence
61-72RKRTKKDKKTKR
Subcellular Location(s) mito 20, nucl 3, plas 2, cyto_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYLCVTQARPAWMLSSVIFLSLPSLFKRLAALSRVERRLLPNHIVCALQRTEQVAREMQERKRTKKDKKTKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.13
4 0.12
5 0.12
6 0.1
7 0.1
8 0.1
9 0.11
10 0.09
11 0.11
12 0.1
13 0.11
14 0.12
15 0.12
16 0.13
17 0.14
18 0.16
19 0.21
20 0.27
21 0.29
22 0.28
23 0.28
24 0.28
25 0.31
26 0.31
27 0.3
28 0.25
29 0.25
30 0.25
31 0.25
32 0.22
33 0.22
34 0.19
35 0.15
36 0.15
37 0.17
38 0.18
39 0.2
40 0.23
41 0.21
42 0.21
43 0.27
44 0.32
45 0.34
46 0.43
47 0.48
48 0.54
49 0.62
50 0.71
51 0.76
52 0.81