Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3AAA6

Protein Details
Accession A0A2T3AAA6    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
56-89SKPARPKTNTQKPIPKERKTSYPKPKEKLHENPSHydrophilic
NLS Segment(s)
PositionSequence
60-81RPKTNTQKPIPKERKTSYPKPK
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MVNLRLVGEEIEVVFRRYWLDTKLQKLQKLQNSRTRSNKRSQMQKPANPVTQNSESKPARPKTNTQKPIPKERKTSYPKPKEKLHENPSQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.14
4 0.15
5 0.17
6 0.16
7 0.25
8 0.29
9 0.35
10 0.44
11 0.48
12 0.49
13 0.53
14 0.58
15 0.58
16 0.62
17 0.62
18 0.62
19 0.64
20 0.67
21 0.71
22 0.72
23 0.69
24 0.68
25 0.7
26 0.67
27 0.7
28 0.69
29 0.7
30 0.69
31 0.68
32 0.68
33 0.63
34 0.61
35 0.51
36 0.47
37 0.42
38 0.4
39 0.38
40 0.32
41 0.35
42 0.32
43 0.35
44 0.43
45 0.41
46 0.42
47 0.44
48 0.52
49 0.54
50 0.65
51 0.69
52 0.69
53 0.74
54 0.72
55 0.79
56 0.8
57 0.77
58 0.75
59 0.72
60 0.74
61 0.74
62 0.79
63 0.78
64 0.8
65 0.82
66 0.8
67 0.84
68 0.82
69 0.83
70 0.83
71 0.8