Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2ZSR1

Protein Details
Accession A0A2T2ZSR1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MLFRTGHMKKKKWERNTSKYIHTHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 18, mito 5, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLFRTGHMKKKKWERNTSKYIHTLTQRKEQKQNGVWERLSGSGVVVSFCFAFLVLMRLFLCVWFFSFLLGCLFLCLCFWL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.85
3 0.88
4 0.83
5 0.78
6 0.74
7 0.67
8 0.61
9 0.58
10 0.57
11 0.51
12 0.56
13 0.58
14 0.57
15 0.63
16 0.62
17 0.63
18 0.61
19 0.66
20 0.61
21 0.59
22 0.53
23 0.46
24 0.42
25 0.34
26 0.28
27 0.18
28 0.12
29 0.07
30 0.07
31 0.07
32 0.06
33 0.05
34 0.05
35 0.05
36 0.05
37 0.04
38 0.04
39 0.04
40 0.07
41 0.07
42 0.08
43 0.08
44 0.09
45 0.09
46 0.09
47 0.1
48 0.07
49 0.09
50 0.1
51 0.1
52 0.1
53 0.1
54 0.11
55 0.11
56 0.12
57 0.1
58 0.09
59 0.1
60 0.09