Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3AIV4

Protein Details
Accession A0A2T3AIV4    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
65-86LCFSRFLAKREKKSPRTRSFATHydrophilic
NLS Segment(s)
PositionSequence
73-81KREKKSPRT
Subcellular Location(s) mito 9extr 9, nucl 4, cyto 4, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences MYFLLGHFRNLALLASQPATAPPGPSTLGRPLSDPARPIPACGTAAPLHLLRLQTATPAFGSCLLCFSRFLAKREKKSPRTRSFATRQPARAHRPTSALLSPPALSSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.11
5 0.1
6 0.13
7 0.13
8 0.13
9 0.12
10 0.13
11 0.14
12 0.15
13 0.18
14 0.21
15 0.24
16 0.23
17 0.24
18 0.25
19 0.27
20 0.27
21 0.26
22 0.21
23 0.26
24 0.25
25 0.24
26 0.23
27 0.22
28 0.22
29 0.2
30 0.22
31 0.14
32 0.14
33 0.15
34 0.13
35 0.12
36 0.13
37 0.13
38 0.1
39 0.1
40 0.1
41 0.09
42 0.09
43 0.09
44 0.07
45 0.07
46 0.07
47 0.09
48 0.1
49 0.08
50 0.11
51 0.11
52 0.11
53 0.12
54 0.13
55 0.19
56 0.22
57 0.25
58 0.34
59 0.41
60 0.48
61 0.57
62 0.66
63 0.67
64 0.74
65 0.83
66 0.81
67 0.81
68 0.78
69 0.78
70 0.75
71 0.73
72 0.72
73 0.68
74 0.65
75 0.66
76 0.7
77 0.69
78 0.69
79 0.65
80 0.58
81 0.55
82 0.52
83 0.5
84 0.45
85 0.39
86 0.33
87 0.32
88 0.29