Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5IL69

Protein Details
Accession V5IL69    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
7-26TTYPGCKCKRWSITPCKAVSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, mito 5.5, cyto_mito 3.5
Family & Domain DBs
KEGG ncr:NCU16924  -  
Amino Acid Sequences MCIAPQTTYPGCKCKRWSITPCKAVSREQRTIQRRFAKEVKDKKKDVEYDAPELEPDWPTGKDCSQFRITVRGLASEEKCPDCILKEEKIRYGYGTSNIDPDVAKRIRKLEFMARDAQPEWSDSEGEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.61
3 0.65
4 0.72
5 0.73
6 0.8
7 0.81
8 0.78
9 0.75
10 0.69
11 0.67
12 0.67
13 0.64
14 0.61
15 0.6
16 0.66
17 0.66
18 0.69
19 0.71
20 0.7
21 0.64
22 0.63
23 0.62
24 0.62
25 0.64
26 0.69
27 0.7
28 0.69
29 0.68
30 0.66
31 0.67
32 0.61
33 0.58
34 0.56
35 0.49
36 0.46
37 0.45
38 0.4
39 0.32
40 0.29
41 0.24
42 0.15
43 0.12
44 0.09
45 0.09
46 0.1
47 0.11
48 0.12
49 0.16
50 0.16
51 0.19
52 0.2
53 0.21
54 0.21
55 0.26
56 0.25
57 0.24
58 0.24
59 0.21
60 0.2
61 0.23
62 0.23
63 0.2
64 0.22
65 0.19
66 0.19
67 0.18
68 0.17
69 0.14
70 0.18
71 0.19
72 0.22
73 0.29
74 0.31
75 0.35
76 0.36
77 0.36
78 0.32
79 0.31
80 0.27
81 0.25
82 0.27
83 0.23
84 0.23
85 0.23
86 0.22
87 0.19
88 0.18
89 0.22
90 0.21
91 0.23
92 0.24
93 0.29
94 0.31
95 0.35
96 0.38
97 0.39
98 0.43
99 0.45
100 0.49
101 0.45
102 0.45
103 0.43
104 0.42
105 0.33
106 0.27
107 0.26
108 0.21