Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1DYT0

Protein Details
Accession A0A0D1DYT0    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MSGRRRSPPPPPRPYKDETSHydrophilic
210-230AAEVKKERTWRQYMNRKGGFNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013957  SNRNP27  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
KEGG uma:UMAG_04183  -  
Pfam View protein in Pfam  
PF08648  SNRNP27  
Amino Acid Sequences MSGRRRSPPPPPRPYKDETSRRGYRNDRGGTSSSQEFRRRRSPSPGYSWSSSSRHDSDRRERGYDDRSAWRGERRDRERDDQRSDRIPPPPRDRPAASDREDTLSRDSRSNHWSYSRPHDEGIHYRRRRSRSRSPPTSSIPEASALARVSTSQTVATVSAPDAKAVGKQDAEDGETTEQDGEEEAMAAMMGFGGFGTTKNKKVAGNAAGAAEVKKERTWRQYMNRKGGFNRPLDKIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.8
3 0.79
4 0.79
5 0.75
6 0.74
7 0.75
8 0.71
9 0.74
10 0.71
11 0.69
12 0.69
13 0.68
14 0.61
15 0.57
16 0.57
17 0.51
18 0.49
19 0.46
20 0.4
21 0.41
22 0.48
23 0.47
24 0.5
25 0.57
26 0.58
27 0.58
28 0.63
29 0.66
30 0.65
31 0.69
32 0.7
33 0.66
34 0.63
35 0.61
36 0.56
37 0.5
38 0.45
39 0.42
40 0.38
41 0.39
42 0.43
43 0.48
44 0.52
45 0.59
46 0.6
47 0.57
48 0.55
49 0.54
50 0.52
51 0.49
52 0.44
53 0.41
54 0.39
55 0.39
56 0.39
57 0.4
58 0.42
59 0.44
60 0.5
61 0.5
62 0.57
63 0.6
64 0.67
65 0.7
66 0.71
67 0.72
68 0.67
69 0.65
70 0.61
71 0.6
72 0.56
73 0.54
74 0.55
75 0.54
76 0.57
77 0.61
78 0.6
79 0.6
80 0.57
81 0.55
82 0.53
83 0.52
84 0.47
85 0.41
86 0.39
87 0.37
88 0.36
89 0.31
90 0.29
91 0.27
92 0.25
93 0.24
94 0.25
95 0.25
96 0.3
97 0.3
98 0.28
99 0.26
100 0.3
101 0.3
102 0.38
103 0.39
104 0.35
105 0.34
106 0.33
107 0.33
108 0.37
109 0.4
110 0.42
111 0.38
112 0.43
113 0.48
114 0.53
115 0.58
116 0.58
117 0.63
118 0.63
119 0.72
120 0.76
121 0.77
122 0.76
123 0.72
124 0.7
125 0.6
126 0.5
127 0.4
128 0.32
129 0.26
130 0.2
131 0.17
132 0.12
133 0.1
134 0.09
135 0.08
136 0.09
137 0.09
138 0.09
139 0.07
140 0.07
141 0.08
142 0.08
143 0.08
144 0.07
145 0.07
146 0.11
147 0.11
148 0.11
149 0.11
150 0.1
151 0.13
152 0.14
153 0.16
154 0.12
155 0.12
156 0.14
157 0.14
158 0.15
159 0.13
160 0.13
161 0.12
162 0.12
163 0.12
164 0.1
165 0.09
166 0.08
167 0.08
168 0.06
169 0.05
170 0.05
171 0.05
172 0.04
173 0.04
174 0.04
175 0.03
176 0.03
177 0.03
178 0.02
179 0.02
180 0.03
181 0.03
182 0.04
183 0.11
184 0.15
185 0.19
186 0.22
187 0.25
188 0.26
189 0.3
190 0.37
191 0.34
192 0.35
193 0.32
194 0.3
195 0.28
196 0.27
197 0.24
198 0.18
199 0.16
200 0.14
201 0.16
202 0.22
203 0.28
204 0.36
205 0.44
206 0.51
207 0.6
208 0.69
209 0.76
210 0.81
211 0.81
212 0.78
213 0.75
214 0.75
215 0.72
216 0.69
217 0.65