Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2ZZZ2

Protein Details
Accession A0A2T2ZZZ2    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
68-105VRADEHKQKRHERPGLKRKRQKSERWRKRFKDGFKATCBasic
NLS Segment(s)
PositionSequence
73-98HKQKRHERPGLKRKRQKSERWRKRFK
Subcellular Location(s) nucl 16, cyto 6, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences MSDLGLGSFSSPSVDDFMAVRKDLGKEKPSEVKYRLRPVIGRTIDLRENVDVARALNLLSMQCAVNKVRADEHKQKRHERPGLKRKRQKSERWRKRFKDGFKATCARVRVLAKQGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.11
4 0.15
5 0.17
6 0.17
7 0.16
8 0.16
9 0.19
10 0.24
11 0.3
12 0.3
13 0.31
14 0.35
15 0.44
16 0.45
17 0.49
18 0.48
19 0.51
20 0.54
21 0.59
22 0.58
23 0.51
24 0.5
25 0.47
26 0.52
27 0.44
28 0.38
29 0.31
30 0.32
31 0.31
32 0.29
33 0.27
34 0.17
35 0.17
36 0.15
37 0.14
38 0.1
39 0.08
40 0.08
41 0.07
42 0.06
43 0.06
44 0.06
45 0.05
46 0.05
47 0.06
48 0.05
49 0.05
50 0.07
51 0.08
52 0.11
53 0.12
54 0.13
55 0.16
56 0.21
57 0.28
58 0.37
59 0.47
60 0.52
61 0.59
62 0.67
63 0.72
64 0.78
65 0.79
66 0.78
67 0.79
68 0.81
69 0.85
70 0.87
71 0.87
72 0.87
73 0.89
74 0.89
75 0.89
76 0.89
77 0.89
78 0.9
79 0.91
80 0.93
81 0.88
82 0.9
83 0.88
84 0.85
85 0.85
86 0.84
87 0.79
88 0.77
89 0.77
90 0.69
91 0.66
92 0.59
93 0.5
94 0.46
95 0.44
96 0.42