Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3AI50

Protein Details
Accession A0A2T3AI50    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
32-53APWPPFKCRKWKLCIRKLLSTSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, mito_nucl 13, nucl 11.5
Family & Domain DBs
Amino Acid Sequences MLQVWSSARSTAPTSDFLRECSISFIACHDLAPWPPFKCRKWKLCIRKLLSTSMQICSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.29
3 0.28
4 0.28
5 0.29
6 0.27
7 0.25
8 0.23
9 0.21
10 0.15
11 0.15
12 0.14
13 0.13
14 0.12
15 0.11
16 0.09
17 0.1
18 0.11
19 0.12
20 0.15
21 0.13
22 0.19
23 0.25
24 0.28
25 0.38
26 0.45
27 0.53
28 0.58
29 0.68
30 0.73
31 0.77
32 0.84
33 0.8
34 0.8
35 0.74
36 0.72
37 0.66
38 0.62
39 0.56