Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3A5V4

Protein Details
Accession A0A2T3A5V4   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
116-144GDTPCWREEKEKKKKKNPRLKPYDSTQEAHydrophilic
NLS Segment(s)
PositionSequence
125-136KEKKKKKNPRLK
Subcellular Location(s) nucl 17, mito_nucl 12.5, mito 6, cyto 4
Family & Domain DBs
Amino Acid Sequences MADLRTPRFLGGVDRTPRRYGAARHKAELKRPASTRTCVKGWWMLAPWRSMKDNKKQPFGSGCTTPLTATLQRKRQVHGVDSSVSLTRSAEDGQTRCWVSLFKSIYYSEPCSEFVGDTPCWREEKEKKKKKNPRLKPYDSTQEAMKARWLETVAAPSPASAFLFSAPALCPRREISACASPLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.47
3 0.48
4 0.48
5 0.46
6 0.45
7 0.45
8 0.49
9 0.53
10 0.53
11 0.55
12 0.64
13 0.64
14 0.67
15 0.67
16 0.59
17 0.57
18 0.55
19 0.59
20 0.55
21 0.55
22 0.55
23 0.51
24 0.49
25 0.42
26 0.42
27 0.4
28 0.36
29 0.34
30 0.3
31 0.29
32 0.3
33 0.33
34 0.32
35 0.3
36 0.32
37 0.35
38 0.4
39 0.45
40 0.53
41 0.56
42 0.62
43 0.6
44 0.6
45 0.59
46 0.56
47 0.5
48 0.42
49 0.37
50 0.3
51 0.3
52 0.25
53 0.2
54 0.19
55 0.2
56 0.26
57 0.3
58 0.35
59 0.41
60 0.42
61 0.43
62 0.46
63 0.44
64 0.39
65 0.35
66 0.31
67 0.26
68 0.25
69 0.24
70 0.19
71 0.16
72 0.13
73 0.1
74 0.08
75 0.07
76 0.07
77 0.08
78 0.1
79 0.11
80 0.12
81 0.15
82 0.15
83 0.14
84 0.14
85 0.13
86 0.12
87 0.19
88 0.19
89 0.16
90 0.18
91 0.19
92 0.21
93 0.24
94 0.25
95 0.19
96 0.18
97 0.19
98 0.18
99 0.18
100 0.15
101 0.13
102 0.15
103 0.14
104 0.14
105 0.15
106 0.16
107 0.17
108 0.17
109 0.24
110 0.3
111 0.4
112 0.51
113 0.58
114 0.67
115 0.77
116 0.87
117 0.9
118 0.92
119 0.92
120 0.92
121 0.93
122 0.9
123 0.86
124 0.82
125 0.81
126 0.73
127 0.64
128 0.54
129 0.51
130 0.44
131 0.38
132 0.36
133 0.27
134 0.24
135 0.25
136 0.24
137 0.19
138 0.19
139 0.24
140 0.2
141 0.2
142 0.2
143 0.17
144 0.17
145 0.16
146 0.15
147 0.1
148 0.1
149 0.08
150 0.1
151 0.1
152 0.1
153 0.1
154 0.18
155 0.21
156 0.21
157 0.23
158 0.24
159 0.32
160 0.32
161 0.35
162 0.34
163 0.39