Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P11115

Protein Details
Accession P11115    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
224-245ARNTLAARKSRERKAQRLEELEHydrophilic
NLS Segment(s)
PositionSequence
231-236RKSRER
Subcellular Location(s) nucl 21.5, cyto_nucl 13.333, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0005667  C:transcription regulator complex  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0000978  F:RNA polymerase II cis-regulatory region sequence-specific DNA binding  
GO:0008652  P:amino acid biosynthetic process  
GO:0001080  P:nitrogen catabolite activation of transcription from RNA polymerase II promoter  
GO:1903833  P:positive regulation of cellular response to amino acid starvation  
KEGG ncr:NCU04050  -  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
CDD cd12193  bZIP_GCN4  
Amino Acid Sequences MFSELDLLDFATFDGGATTEAAFASPANQTYDLSSSVPSSVSNMGTVSPQELLLHEPYLSAPSSTALTALTSPSLFDGSPDFDTFDISPNFGHSDLENPDTWFSLFPDATPLPQAQAQVQTQPQTQTQTEQQTQPLPELVQSVQPTVQPTVEQTVHSVEASPATPSEDLEVLSPGSGHQRRKSSVSPPSGRHSSVAGVGSRRRDKPLPPIIVEDPSDVVAMKRARNTLAARKSRERKAQRLEELEAKIEELIAERDRWKNLALAHGASTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.06
4 0.07
5 0.07
6 0.07
7 0.07
8 0.07
9 0.07
10 0.06
11 0.08
12 0.09
13 0.1
14 0.13
15 0.14
16 0.14
17 0.16
18 0.18
19 0.18
20 0.17
21 0.17
22 0.14
23 0.14
24 0.14
25 0.12
26 0.12
27 0.13
28 0.13
29 0.13
30 0.12
31 0.12
32 0.13
33 0.13
34 0.12
35 0.1
36 0.09
37 0.09
38 0.09
39 0.12
40 0.12
41 0.13
42 0.11
43 0.11
44 0.11
45 0.13
46 0.12
47 0.09
48 0.08
49 0.08
50 0.09
51 0.09
52 0.09
53 0.07
54 0.07
55 0.08
56 0.08
57 0.08
58 0.07
59 0.07
60 0.07
61 0.08
62 0.07
63 0.07
64 0.08
65 0.11
66 0.12
67 0.13
68 0.13
69 0.12
70 0.14
71 0.14
72 0.16
73 0.14
74 0.12
75 0.12
76 0.12
77 0.14
78 0.12
79 0.12
80 0.08
81 0.12
82 0.13
83 0.16
84 0.15
85 0.14
86 0.15
87 0.15
88 0.15
89 0.11
90 0.1
91 0.11
92 0.11
93 0.1
94 0.15
95 0.14
96 0.14
97 0.15
98 0.14
99 0.12
100 0.13
101 0.14
102 0.1
103 0.13
104 0.14
105 0.15
106 0.16
107 0.17
108 0.17
109 0.18
110 0.18
111 0.18
112 0.18
113 0.17
114 0.2
115 0.24
116 0.25
117 0.25
118 0.25
119 0.25
120 0.25
121 0.23
122 0.19
123 0.13
124 0.12
125 0.12
126 0.11
127 0.11
128 0.11
129 0.11
130 0.11
131 0.12
132 0.13
133 0.12
134 0.12
135 0.09
136 0.09
137 0.12
138 0.13
139 0.12
140 0.11
141 0.12
142 0.13
143 0.12
144 0.12
145 0.08
146 0.09
147 0.09
148 0.08
149 0.07
150 0.08
151 0.08
152 0.07
153 0.09
154 0.08
155 0.08
156 0.08
157 0.09
158 0.07
159 0.07
160 0.07
161 0.06
162 0.14
163 0.18
164 0.22
165 0.26
166 0.31
167 0.34
168 0.39
169 0.43
170 0.43
171 0.47
172 0.52
173 0.53
174 0.52
175 0.56
176 0.55
177 0.51
178 0.45
179 0.37
180 0.29
181 0.26
182 0.25
183 0.2
184 0.19
185 0.22
186 0.29
187 0.34
188 0.34
189 0.37
190 0.38
191 0.4
192 0.47
193 0.54
194 0.52
195 0.48
196 0.51
197 0.48
198 0.48
199 0.45
200 0.35
201 0.26
202 0.21
203 0.19
204 0.14
205 0.11
206 0.14
207 0.17
208 0.18
209 0.21
210 0.22
211 0.24
212 0.3
213 0.35
214 0.39
215 0.46
216 0.52
217 0.55
218 0.64
219 0.71
220 0.74
221 0.79
222 0.78
223 0.78
224 0.8
225 0.83
226 0.81
227 0.79
228 0.75
229 0.72
230 0.65
231 0.58
232 0.48
233 0.38
234 0.29
235 0.23
236 0.18
237 0.13
238 0.14
239 0.13
240 0.16
241 0.2
242 0.24
243 0.26
244 0.28
245 0.27
246 0.27
247 0.27
248 0.32
249 0.32
250 0.29