Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3ABL0

Protein Details
Accession A0A2T3ABL0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
81-104GFLKARGKGAPKKKKGPPDAKKRRBasic
NLS Segment(s)
PositionSequence
84-104KARGKGAPKKKKGPPDAKKRR
Subcellular Location(s) mito 23, mito_nucl 13.333, cyto_mito 12.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MSVPRERLLQLVQARCRIFATTFNPENVRTGNKILRQRLRGPALAAYYPRKMYTMREIADLYGPELEFILEDEEDRLEQIGFLKARGKGAPKKKKGPPDAKKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.42
3 0.41
4 0.36
5 0.3
6 0.28
7 0.3
8 0.32
9 0.34
10 0.36
11 0.37
12 0.35
13 0.36
14 0.31
15 0.28
16 0.22
17 0.24
18 0.27
19 0.31
20 0.38
21 0.44
22 0.49
23 0.51
24 0.53
25 0.56
26 0.55
27 0.5
28 0.44
29 0.38
30 0.33
31 0.29
32 0.26
33 0.21
34 0.2
35 0.19
36 0.18
37 0.16
38 0.15
39 0.16
40 0.21
41 0.24
42 0.23
43 0.24
44 0.24
45 0.24
46 0.24
47 0.22
48 0.15
49 0.1
50 0.1
51 0.07
52 0.07
53 0.07
54 0.05
55 0.05
56 0.06
57 0.05
58 0.05
59 0.06
60 0.06
61 0.06
62 0.07
63 0.07
64 0.05
65 0.06
66 0.07
67 0.12
68 0.12
69 0.13
70 0.17
71 0.18
72 0.21
73 0.24
74 0.3
75 0.35
76 0.46
77 0.56
78 0.6
79 0.69
80 0.75
81 0.82
82 0.85
83 0.87
84 0.87