Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3ABB3

Protein Details
Accession A0A2T3ABB3    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAANKKKKPRLKLSTGRPPVTSHydrophilic
NLS Segment(s)
PositionSequence
5-26KKKKPRLKLSTGRPPVTSKPKS
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021867  Bmt2/SAMTOR  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0005730  C:nucleolus  
GO:0016433  F:rRNA (adenine) methyltransferase activity  
Pfam View protein in Pfam  
PF11968  Bmt2  
Amino Acid Sequences MAANKKKKPRLKLSTGRPPVTSKPKSISRQATRALINKIHQLEKRKQQAARNGDGAAEAKISAEISSLGGLEKYQQASLQGQRNDRGGDSSKVLMDWLKAIETEQQKTTTSTRQWSSLRMLEVGALSTTNACSRSGMFTIERIDLNSQGEGILQQDFMERPLPKDDAERFDIISMSLVLNFVPDPEGRGDMLLRTLEFLRCPVGLNSETSEADLSFPFPSLFLVLPAPCVTNSRYLDEEKLGAILASLGYTIVKSRTTHKLVYYLLKRAKVQPPLLGSKASFTKRELRSGPNRNNFAIVLKSSSSKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.9
3 0.83
4 0.75
5 0.7
6 0.68
7 0.69
8 0.63
9 0.58
10 0.56
11 0.62
12 0.65
13 0.69
14 0.71
15 0.68
16 0.71
17 0.7
18 0.69
19 0.65
20 0.65
21 0.61
22 0.56
23 0.5
24 0.5
25 0.49
26 0.5
27 0.49
28 0.51
29 0.54
30 0.58
31 0.66
32 0.65
33 0.66
34 0.67
35 0.72
36 0.71
37 0.68
38 0.61
39 0.51
40 0.44
41 0.4
42 0.34
43 0.24
44 0.17
45 0.11
46 0.08
47 0.08
48 0.08
49 0.07
50 0.06
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.07
59 0.1
60 0.11
61 0.11
62 0.11
63 0.13
64 0.18
65 0.24
66 0.3
67 0.31
68 0.34
69 0.36
70 0.37
71 0.36
72 0.32
73 0.3
74 0.26
75 0.23
76 0.23
77 0.21
78 0.19
79 0.18
80 0.18
81 0.15
82 0.12
83 0.11
84 0.09
85 0.08
86 0.08
87 0.08
88 0.14
89 0.17
90 0.19
91 0.2
92 0.21
93 0.22
94 0.24
95 0.26
96 0.26
97 0.26
98 0.29
99 0.29
100 0.33
101 0.33
102 0.34
103 0.36
104 0.33
105 0.3
106 0.25
107 0.24
108 0.18
109 0.17
110 0.14
111 0.1
112 0.06
113 0.05
114 0.05
115 0.05
116 0.06
117 0.07
118 0.06
119 0.07
120 0.08
121 0.1
122 0.11
123 0.12
124 0.11
125 0.12
126 0.14
127 0.15
128 0.14
129 0.13
130 0.13
131 0.12
132 0.12
133 0.11
134 0.08
135 0.07
136 0.07
137 0.06
138 0.06
139 0.05
140 0.04
141 0.04
142 0.05
143 0.05
144 0.06
145 0.1
146 0.1
147 0.11
148 0.14
149 0.15
150 0.14
151 0.19
152 0.21
153 0.21
154 0.24
155 0.23
156 0.21
157 0.2
158 0.2
159 0.15
160 0.12
161 0.09
162 0.06
163 0.05
164 0.05
165 0.05
166 0.05
167 0.05
168 0.04
169 0.05
170 0.05
171 0.06
172 0.07
173 0.09
174 0.08
175 0.09
176 0.09
177 0.08
178 0.1
179 0.08
180 0.07
181 0.08
182 0.09
183 0.09
184 0.09
185 0.1
186 0.1
187 0.1
188 0.11
189 0.1
190 0.13
191 0.14
192 0.15
193 0.16
194 0.17
195 0.16
196 0.15
197 0.15
198 0.11
199 0.11
200 0.1
201 0.1
202 0.08
203 0.08
204 0.08
205 0.07
206 0.07
207 0.08
208 0.08
209 0.08
210 0.1
211 0.09
212 0.11
213 0.11
214 0.12
215 0.1
216 0.13
217 0.13
218 0.19
219 0.21
220 0.23
221 0.25
222 0.26
223 0.28
224 0.28
225 0.27
226 0.19
227 0.17
228 0.14
229 0.11
230 0.09
231 0.07
232 0.05
233 0.04
234 0.04
235 0.04
236 0.04
237 0.04
238 0.06
239 0.07
240 0.1
241 0.11
242 0.17
243 0.26
244 0.31
245 0.34
246 0.35
247 0.4
248 0.41
249 0.49
250 0.49
251 0.49
252 0.5
253 0.51
254 0.52
255 0.54
256 0.58
257 0.57
258 0.55
259 0.52
260 0.53
261 0.55
262 0.54
263 0.48
264 0.4
265 0.37
266 0.41
267 0.39
268 0.36
269 0.33
270 0.4
271 0.42
272 0.5
273 0.49
274 0.51
275 0.58
276 0.66
277 0.73
278 0.73
279 0.74
280 0.67
281 0.65
282 0.57
283 0.49
284 0.43
285 0.35
286 0.29
287 0.26