Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q7S709

Protein Details
Accession Q7S709    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
8-29QIPNNHFRKDWQRRVRCHFDQAHydrophilic
NLS Segment(s)
PositionSequence
32-42KASRRVARQAK
185-214LRKARSDAKLIGVREKRAKDKAAAEAEKSK
Subcellular Location(s) nucl 17, cyto 6, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001380  Ribosomal_L13e  
IPR018256  Ribosomal_L13e_CS  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ncr:NCU05554  -  
Pfam View protein in Pfam  
PF01294  Ribosomal_L13e  
PROSITE View protein in PROSITE  
PS01104  RIBOSOMAL_L13E  
Amino Acid Sequences MAIKHNQQIPNNHFRKDWQRRVRCHFDQAGKKASRRVARQAKAAALAPRPVDKLRPIVRCPTIKYNRRTRLGRGFSLAELKAAGIPKLVAPTIGISVDPRRANLSEESLAANVERLKAYQARLVVFPRKSNKPKKADTPKDQQTGEFVKSVEAVFGVERPIASGFKEIPKSELPSNIEGGAFRALRKARSDAKLIGVREKRAKDKAAAEAEKSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.6
3 0.61
4 0.64
5 0.64
6 0.7
7 0.77
8 0.85
9 0.88
10 0.82
11 0.8
12 0.77
13 0.76
14 0.76
15 0.72
16 0.73
17 0.68
18 0.65
19 0.63
20 0.62
21 0.6
22 0.56
23 0.61
24 0.62
25 0.61
26 0.65
27 0.63
28 0.57
29 0.52
30 0.5
31 0.43
32 0.35
33 0.34
34 0.28
35 0.27
36 0.27
37 0.26
38 0.25
39 0.24
40 0.31
41 0.35
42 0.4
43 0.41
44 0.46
45 0.51
46 0.52
47 0.54
48 0.56
49 0.58
50 0.6
51 0.65
52 0.68
53 0.71
54 0.74
55 0.73
56 0.69
57 0.7
58 0.67
59 0.61
60 0.54
61 0.46
62 0.39
63 0.4
64 0.33
65 0.22
66 0.16
67 0.14
68 0.13
69 0.12
70 0.11
71 0.07
72 0.07
73 0.07
74 0.08
75 0.08
76 0.06
77 0.06
78 0.06
79 0.07
80 0.07
81 0.06
82 0.06
83 0.08
84 0.13
85 0.13
86 0.13
87 0.14
88 0.15
89 0.17
90 0.17
91 0.18
92 0.14
93 0.15
94 0.15
95 0.13
96 0.12
97 0.1
98 0.1
99 0.07
100 0.07
101 0.06
102 0.06
103 0.08
104 0.1
105 0.11
106 0.12
107 0.14
108 0.14
109 0.16
110 0.2
111 0.24
112 0.24
113 0.28
114 0.32
115 0.39
116 0.48
117 0.56
118 0.62
119 0.63
120 0.68
121 0.73
122 0.79
123 0.8
124 0.78
125 0.78
126 0.77
127 0.75
128 0.69
129 0.59
130 0.53
131 0.46
132 0.4
133 0.32
134 0.23
135 0.18
136 0.18
137 0.18
138 0.13
139 0.09
140 0.07
141 0.06
142 0.07
143 0.07
144 0.06
145 0.06
146 0.07
147 0.09
148 0.09
149 0.09
150 0.11
151 0.13
152 0.18
153 0.23
154 0.22
155 0.24
156 0.27
157 0.31
158 0.31
159 0.35
160 0.33
161 0.31
162 0.32
163 0.29
164 0.26
165 0.22
166 0.21
167 0.2
168 0.17
169 0.14
170 0.19
171 0.21
172 0.24
173 0.27
174 0.32
175 0.36
176 0.4
177 0.45
178 0.41
179 0.47
180 0.5
181 0.48
182 0.52
183 0.48
184 0.51
185 0.54
186 0.58
187 0.58
188 0.58
189 0.61
190 0.57
191 0.58
192 0.6
193 0.62
194 0.59