Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3A0G1

Protein Details
Accession A0A2T3A0G1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
20-41LATFSSRRWKRRPSMRIWRSALHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, extr 7, cyto 3, plas 2, cyto_nucl 2
Family & Domain DBs
Amino Acid Sequences MRSLSSCWRFIMSCVSSMSLATFSSRRWKRRPSMRIWRSALGGRPGPWCWGVGDCWTARPCCSAALAVLATCCWCRAASVGSMLAVWAWAWAWGQSSGAEAEPEAMASGARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.23
4 0.22
5 0.22
6 0.13
7 0.12
8 0.12
9 0.11
10 0.11
11 0.22
12 0.29
13 0.36
14 0.43
15 0.52
16 0.59
17 0.69
18 0.76
19 0.76
20 0.8
21 0.8
22 0.82
23 0.77
24 0.69
25 0.61
26 0.55
27 0.48
28 0.41
29 0.35
30 0.27
31 0.26
32 0.24
33 0.23
34 0.21
35 0.18
36 0.14
37 0.13
38 0.12
39 0.11
40 0.13
41 0.11
42 0.13
43 0.14
44 0.14
45 0.13
46 0.13
47 0.12
48 0.11
49 0.11
50 0.09
51 0.08
52 0.09
53 0.09
54 0.08
55 0.07
56 0.06
57 0.06
58 0.06
59 0.06
60 0.05
61 0.05
62 0.06
63 0.07
64 0.1
65 0.1
66 0.12
67 0.13
68 0.12
69 0.12
70 0.11
71 0.09
72 0.07
73 0.06
74 0.04
75 0.03
76 0.04
77 0.04
78 0.05
79 0.07
80 0.07
81 0.08
82 0.08
83 0.1
84 0.1
85 0.1
86 0.1
87 0.08
88 0.09
89 0.09
90 0.09
91 0.08
92 0.07