Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2ZRY3

Protein Details
Accession A0A2T2ZRY3   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
50-75TNIPKKWNLKKICKQAKKRYNCNGTVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto 3.5, cyto_pero 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001950  SUI1  
IPR036877  SUI1_dom_sf  
IPR005874  SUI1_euk  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0003743  F:translation initiation factor activity  
Pfam View protein in Pfam  
PF01253  SUI1  
PROSITE View protein in PROSITE  
PS50296  SUI1  
CDD cd11566  eIF1_SUI1  
Amino Acid Sequences MSIENNKDLDPFAEVDESDGEGEKKATKAAEKIEIRIQQRNGRKTLTTVTNIPKKWNLKKICKQAKKRYNCNGTVIEDEEHGQVIQLQGDQRNNMHDFLCGEITNDEKNTGLGFNKDMVRVHGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.14
4 0.14
5 0.11
6 0.11
7 0.1
8 0.09
9 0.11
10 0.11
11 0.11
12 0.12
13 0.13
14 0.15
15 0.19
16 0.22
17 0.31
18 0.3
19 0.32
20 0.38
21 0.42
22 0.42
23 0.45
24 0.45
25 0.44
26 0.5
27 0.53
28 0.49
29 0.45
30 0.43
31 0.39
32 0.4
33 0.36
34 0.31
35 0.31
36 0.35
37 0.39
38 0.39
39 0.39
40 0.4
41 0.43
42 0.46
43 0.51
44 0.52
45 0.55
46 0.63
47 0.72
48 0.76
49 0.78
50 0.82
51 0.84
52 0.85
53 0.84
54 0.85
55 0.84
56 0.81
57 0.74
58 0.69
59 0.61
60 0.53
61 0.46
62 0.38
63 0.29
64 0.22
65 0.2
66 0.15
67 0.13
68 0.1
69 0.08
70 0.07
71 0.07
72 0.07
73 0.07
74 0.09
75 0.12
76 0.14
77 0.16
78 0.16
79 0.2
80 0.21
81 0.21
82 0.2
83 0.18
84 0.17
85 0.18
86 0.19
87 0.14
88 0.14
89 0.13
90 0.15
91 0.16
92 0.16
93 0.15
94 0.13
95 0.13
96 0.13
97 0.14
98 0.14
99 0.14
100 0.15
101 0.18
102 0.21
103 0.23
104 0.23