FuNGI

A0A2T3A9A2

Protein Details

Accession

A0A2T3A9A2

Localization Confidence

Medium

Confidence Score

11.9

NoLS Segment(s)

Position	Sequence	Protein Nature
153-177	NIPITPSPNRSRRRRSPSPPPESPS	Hydrophilic

NLS Segment(s)

Position	Sequence
165-166	RR
459-462	RRGK

Subcellular Location(s)

plas 12, cyto 6, nucl 5, mito 1, extr 1, pero 1, E.R. 1

Family & Domain DBs

InterPro	View protein in InterPro IPR023395 Mt_carrier_dom_sf
Gene Ontology	GO:0005743 C:mitochondrial inner membrane

Amino Acid Sequences

MASNNRQGVNPLRPYYVPPTIGEPNVEPSNIPGPNAFSRPNGSSTKYASKARDMFSDLDYKDYISDSSPSMVENIKEVINELMWKYTTVFLAQPFDAAKLILQVRSQDDVGGMGASPNLAPSPAVSRQSSYKAPPLNELSDSEGDEPAYFTSNIPITPSPNRSRRRRSPSPPPESPSSTKAPNLPPHMLNIRRPDSIGEVLSQFWHKEGAWGVCKGTNVTFVYKVLHSLLESWSRSLLSALFDVPDLGLKTDMDRLVDIASPYPWASLCVAAAAAVVTSFILSPLDLVRTRSIITSSRSSRRTLGTLRSLPSYICPSSLWVPTILHAFIQPILRLSTPLALRTKFMIDSEVSPTTFSLAKFCSSTVALFINLPMETVLRRGQVAVLSSPQYVQAIEGGDSLAKVSRSNEATPAASASFEPIVSPGKYDGIFGTMYTIVNEEGSRAVPTTAAAKARAATRRGKPKVAETVYRRGQGVEGLWRGWKVNWWGLVGLWAAANIGGSDGEF

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.48
2	0.51
3	0.5
4	0.43
5	0.36
6	0.39
7	0.41
8	0.41
9	0.39
10	0.33
11	0.32
12	0.32
13	0.31
14	0.24
15	0.23
16	0.29
17	0.27
18	0.26
19	0.21
20	0.24
21	0.29
22	0.33
23	0.31
24	0.26
25	0.31
26	0.33
27	0.37
28	0.36
29	0.35
30	0.36
31	0.4
32	0.46
33	0.47
34	0.51
35	0.49
36	0.54
37	0.56
38	0.54
39	0.52
40	0.47
41	0.44
42	0.4
43	0.45
44	0.36
45	0.33
46	0.3
47	0.26
48	0.23
49	0.21
50	0.19
51	0.13
52	0.14
53	0.13
54	0.14
55	0.14
56	0.13
57	0.14
58	0.16
59	0.14
60	0.14
61	0.15
62	0.14
63	0.14
64	0.14
65	0.13
66	0.12
67	0.14
68	0.13
69	0.14
70	0.13
71	0.14
72	0.15
73	0.16
74	0.15
75	0.15
76	0.16
77	0.16
78	0.19
79	0.19
80	0.19
81	0.17
82	0.17
83	0.16
84	0.14
85	0.12
86	0.13
87	0.15
88	0.15
89	0.15
90	0.17
91	0.2
92	0.22
93	0.22
94	0.17
95	0.16
96	0.14
97	0.14
98	0.11
99	0.08
100	0.06
101	0.05
102	0.05
103	0.05
104	0.05
105	0.04
106	0.04
107	0.04
108	0.05
109	0.11
110	0.15
111	0.19
112	0.19
113	0.21
114	0.25
115	0.3
116	0.33
117	0.31
118	0.33
119	0.35
120	0.35
121	0.38
122	0.39
123	0.37
124	0.35
125	0.33
126	0.3
127	0.26
128	0.27
129	0.22
130	0.18
131	0.16
132	0.14
133	0.14
134	0.1
135	0.11
136	0.1
137	0.08
138	0.11
139	0.11
140	0.11
141	0.14
142	0.14
143	0.16
144	0.21
145	0.28
146	0.33
147	0.41
148	0.5
149	0.57
150	0.66
151	0.73
152	0.77
153	0.81
154	0.81
155	0.84
156	0.86
157	0.86
158	0.82
159	0.76
160	0.72
161	0.68
162	0.63
163	0.56
164	0.48
165	0.42
166	0.37
167	0.38
168	0.39
169	0.39
170	0.41
171	0.4
172	0.36
173	0.38
174	0.43
175	0.41
176	0.4
177	0.41
178	0.39
179	0.36
180	0.36
181	0.33
182	0.29
183	0.28
184	0.23
185	0.17
186	0.14
187	0.14
188	0.14
189	0.14
190	0.1
191	0.08
192	0.09
193	0.08
194	0.09
195	0.12
196	0.15
197	0.17
198	0.18
199	0.18
200	0.18
201	0.19
202	0.18
203	0.15
204	0.16
205	0.14
206	0.15
207	0.15
208	0.14
209	0.16
210	0.15
211	0.15
212	0.11
213	0.1
214	0.09
215	0.09
216	0.11
217	0.14
218	0.14
219	0.14
220	0.14
221	0.13
222	0.13
223	0.12
224	0.11
225	0.07
226	0.07
227	0.07
228	0.07
229	0.07
230	0.07
231	0.06
232	0.07
233	0.05
234	0.05
235	0.05
236	0.05
237	0.06
238	0.09
239	0.09
240	0.08
241	0.08
242	0.08
243	0.08
244	0.09
245	0.09
246	0.07
247	0.07
248	0.07
249	0.07
250	0.07
251	0.06
252	0.06
253	0.07
254	0.06
255	0.06
256	0.06
257	0.05
258	0.05
259	0.05
260	0.04
261	0.03
262	0.02
263	0.02
264	0.02
265	0.02
266	0.02
267	0.03
268	0.03
269	0.03
270	0.03
271	0.04
272	0.07
273	0.07
274	0.09
275	0.1
276	0.11
277	0.11
278	0.11
279	0.13
280	0.14
281	0.17
282	0.22
283	0.26
284	0.32
285	0.34
286	0.35
287	0.36
288	0.35
289	0.36
290	0.34
291	0.34
292	0.35
293	0.37
294	0.37
295	0.36
296	0.34
297	0.29
298	0.27
299	0.26
300	0.19
301	0.16
302	0.15
303	0.16
304	0.18
305	0.2
306	0.18
307	0.14
308	0.14
309	0.14
310	0.16
311	0.14
312	0.11
313	0.1
314	0.09
315	0.1
316	0.12
317	0.11
318	0.1
319	0.11
320	0.11
321	0.12
322	0.12
323	0.14
324	0.14
325	0.18
326	0.2
327	0.19
328	0.2
329	0.21
330	0.22
331	0.18
332	0.18
333	0.16
334	0.14
335	0.15
336	0.19
337	0.19
338	0.17
339	0.17
340	0.16
341	0.16
342	0.17
343	0.15
344	0.13
345	0.13
346	0.14
347	0.14
348	0.14
349	0.15
350	0.14
351	0.14
352	0.13
353	0.13
354	0.12
355	0.11
356	0.11
357	0.11
358	0.1
359	0.1
360	0.08
361	0.07
362	0.07
363	0.09
364	0.11
365	0.1
366	0.11
367	0.11
368	0.12
369	0.13
370	0.15
371	0.14
372	0.15
373	0.15
374	0.16
375	0.15
376	0.15
377	0.14
378	0.12
379	0.1
380	0.1
381	0.09
382	0.09
383	0.09
384	0.09
385	0.08
386	0.08
387	0.08
388	0.08
389	0.08
390	0.08
391	0.09
392	0.15
393	0.19
394	0.2
395	0.23
396	0.24
397	0.24
398	0.24
399	0.24
400	0.19
401	0.16
402	0.14
403	0.13
404	0.12
405	0.1
406	0.1
407	0.1
408	0.14
409	0.13
410	0.15
411	0.13
412	0.15
413	0.16
414	0.16
415	0.15
416	0.13
417	0.13
418	0.12
419	0.14
420	0.12
421	0.12
422	0.12
423	0.12
424	0.1
425	0.11
426	0.11
427	0.09
428	0.09
429	0.1
430	0.1
431	0.1
432	0.1
433	0.09
434	0.1
435	0.12
436	0.15
437	0.17
438	0.17
439	0.17
440	0.2
441	0.27
442	0.32
443	0.33
444	0.38
445	0.45
446	0.55
447	0.6
448	0.64
449	0.62
450	0.64
451	0.7
452	0.67
453	0.68
454	0.63
455	0.67
456	0.67
457	0.66
458	0.58
459	0.48
460	0.43
461	0.37
462	0.34
463	0.32
464	0.28
465	0.26
466	0.28
467	0.28
468	0.29
469	0.26
470	0.29
471	0.27
472	0.31
473	0.32
474	0.32
475	0.32
476	0.3
477	0.32
478	0.26
479	0.2
480	0.14
481	0.11
482	0.09
483	0.08
484	0.08
485	0.05
486	0.06

A0A2T3A9A2

3D AlphaFold-predicted Structure Viewer