Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q7S7L8

Protein Details
Accession Q7S7L8    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
58-86SDSDRSNDGKSKKKRTERRNKFKTSEVWQHydrophilic
NLS Segment(s)
PositionSequence
46-78KSAKRKARSESPSDSDRSNDGKSKKKRTERRNK
Subcellular Location(s) nucl 13.5, cyto_nucl 10.333, cyto 6, cyto_mito 5.333, mito 3.5
Family & Domain DBs
KEGG ncr:NCU08863  -  
Amino Acid Sequences MPSAPSWLLDSASQTSHSVPKTPTIKKEPGTEESPRVLAQVEPTPKSAKRKARSESPSDSDRSNDGKSKKKRTERRNKFKTSEVWQYLVNVSSNTFDEPYGSLTKTRYMRNIVALPRKRELPAVWATRLASEKPSSEILQLLIAYLVGDDPGGFLCGLNGPDCAGKWRITGPAMATFLDDKEAIHKACAFPKCVFCPELEDSNSTSGKRKCCNTVYRDSDDPSMPEIWVPPTPALAPDPVPTPVSTPVHTPAPTSALNPTPSPAPSTQAATALPASLNPETPSHQLHHEAQAQEGNVYLASLWEQRNEAMYLSGPINVSTSYAHSAGWLHQREGQILPIGADSGATLQILDLENKGATVPLPSDSHNLVCIVFEGTVEVILQDTPVFTLSRGGQWSVGVGKECRVRNPRIGTKAILYNIGAPVRQNDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.26
4 0.26
5 0.28
6 0.27
7 0.34
8 0.42
9 0.48
10 0.54
11 0.57
12 0.64
13 0.62
14 0.7
15 0.67
16 0.64
17 0.63
18 0.6
19 0.56
20 0.51
21 0.49
22 0.4
23 0.34
24 0.29
25 0.24
26 0.22
27 0.25
28 0.28
29 0.28
30 0.31
31 0.36
32 0.4
33 0.48
34 0.53
35 0.55
36 0.58
37 0.65
38 0.7
39 0.75
40 0.78
41 0.77
42 0.76
43 0.72
44 0.68
45 0.61
46 0.55
47 0.47
48 0.44
49 0.4
50 0.36
51 0.37
52 0.38
53 0.46
54 0.55
55 0.63
56 0.69
57 0.75
58 0.81
59 0.85
60 0.9
61 0.92
62 0.93
63 0.93
64 0.93
65 0.86
66 0.84
67 0.8
68 0.76
69 0.75
70 0.67
71 0.58
72 0.49
73 0.47
74 0.41
75 0.35
76 0.28
77 0.17
78 0.14
79 0.14
80 0.15
81 0.14
82 0.13
83 0.11
84 0.11
85 0.12
86 0.14
87 0.16
88 0.16
89 0.16
90 0.17
91 0.23
92 0.27
93 0.3
94 0.31
95 0.34
96 0.36
97 0.4
98 0.45
99 0.46
100 0.52
101 0.54
102 0.54
103 0.51
104 0.51
105 0.46
106 0.43
107 0.36
108 0.32
109 0.34
110 0.35
111 0.33
112 0.32
113 0.31
114 0.31
115 0.32
116 0.26
117 0.22
118 0.19
119 0.18
120 0.19
121 0.21
122 0.19
123 0.18
124 0.18
125 0.15
126 0.14
127 0.13
128 0.1
129 0.08
130 0.07
131 0.06
132 0.05
133 0.04
134 0.03
135 0.03
136 0.03
137 0.03
138 0.03
139 0.04
140 0.04
141 0.04
142 0.04
143 0.06
144 0.06
145 0.07
146 0.07
147 0.07
148 0.07
149 0.08
150 0.1
151 0.11
152 0.11
153 0.12
154 0.13
155 0.15
156 0.16
157 0.17
158 0.15
159 0.17
160 0.18
161 0.17
162 0.16
163 0.13
164 0.13
165 0.13
166 0.11
167 0.07
168 0.09
169 0.11
170 0.11
171 0.11
172 0.12
173 0.13
174 0.19
175 0.21
176 0.21
177 0.21
178 0.25
179 0.26
180 0.28
181 0.27
182 0.21
183 0.24
184 0.24
185 0.26
186 0.23
187 0.22
188 0.2
189 0.23
190 0.24
191 0.19
192 0.22
193 0.22
194 0.26
195 0.29
196 0.3
197 0.33
198 0.39
199 0.45
200 0.45
201 0.51
202 0.52
203 0.52
204 0.51
205 0.47
206 0.43
207 0.36
208 0.31
209 0.23
210 0.18
211 0.13
212 0.12
213 0.11
214 0.1
215 0.1
216 0.11
217 0.09
218 0.09
219 0.09
220 0.09
221 0.09
222 0.09
223 0.09
224 0.09
225 0.1
226 0.11
227 0.11
228 0.11
229 0.12
230 0.15
231 0.16
232 0.16
233 0.16
234 0.17
235 0.2
236 0.2
237 0.19
238 0.15
239 0.18
240 0.17
241 0.16
242 0.17
243 0.17
244 0.18
245 0.17
246 0.18
247 0.15
248 0.15
249 0.18
250 0.16
251 0.15
252 0.15
253 0.17
254 0.17
255 0.17
256 0.16
257 0.14
258 0.14
259 0.11
260 0.1
261 0.08
262 0.1
263 0.09
264 0.1
265 0.1
266 0.11
267 0.14
268 0.16
269 0.18
270 0.17
271 0.18
272 0.22
273 0.23
274 0.27
275 0.3
276 0.28
277 0.27
278 0.27
279 0.25
280 0.21
281 0.19
282 0.13
283 0.08
284 0.07
285 0.06
286 0.04
287 0.05
288 0.09
289 0.1
290 0.11
291 0.12
292 0.12
293 0.14
294 0.15
295 0.14
296 0.11
297 0.11
298 0.11
299 0.11
300 0.13
301 0.11
302 0.1
303 0.11
304 0.1
305 0.1
306 0.09
307 0.11
308 0.11
309 0.12
310 0.11
311 0.11
312 0.12
313 0.16
314 0.24
315 0.24
316 0.23
317 0.27
318 0.28
319 0.29
320 0.29
321 0.27
322 0.21
323 0.19
324 0.18
325 0.14
326 0.13
327 0.1
328 0.09
329 0.07
330 0.06
331 0.06
332 0.05
333 0.05
334 0.04
335 0.07
336 0.08
337 0.09
338 0.09
339 0.1
340 0.1
341 0.1
342 0.1
343 0.08
344 0.07
345 0.08
346 0.09
347 0.1
348 0.12
349 0.14
350 0.18
351 0.2
352 0.2
353 0.2
354 0.19
355 0.16
356 0.15
357 0.14
358 0.12
359 0.1
360 0.09
361 0.08
362 0.08
363 0.08
364 0.07
365 0.06
366 0.06
367 0.05
368 0.06
369 0.05
370 0.05
371 0.05
372 0.07
373 0.07
374 0.07
375 0.12
376 0.13
377 0.18
378 0.2
379 0.21
380 0.2
381 0.2
382 0.22
383 0.2
384 0.21
385 0.2
386 0.18
387 0.23
388 0.29
389 0.31
390 0.38
391 0.43
392 0.47
393 0.53
394 0.62
395 0.66
396 0.66
397 0.68
398 0.62
399 0.6
400 0.6
401 0.53
402 0.46
403 0.37
404 0.34
405 0.34
406 0.33
407 0.28
408 0.22