Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3AE67

Protein Details
Accession A0A2T3AE67   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
53-74MRSPRGKTRPARHQHQHNPATHBasic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 10, cyto 3
Family & Domain DBs
Amino Acid Sequences MSCIYPALLLQPGTLSTGSVVPWTNHALSGVLKWRKRQCSLDSIRKLIQQRQMRSPRGKTRPARHQHQHNPATHSLCGQISYLKLGTCTQALVSC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.1
3 0.08
4 0.09
5 0.09
6 0.1
7 0.11
8 0.1
9 0.12
10 0.15
11 0.14
12 0.14
13 0.14
14 0.13
15 0.12
16 0.14
17 0.21
18 0.24
19 0.26
20 0.33
21 0.4
22 0.46
23 0.5
24 0.53
25 0.49
26 0.53
27 0.59
28 0.62
29 0.59
30 0.56
31 0.53
32 0.51
33 0.5
34 0.44
35 0.44
36 0.4
37 0.4
38 0.46
39 0.53
40 0.56
41 0.59
42 0.62
43 0.64
44 0.65
45 0.7
46 0.69
47 0.7
48 0.74
49 0.76
50 0.78
51 0.76
52 0.8
53 0.8
54 0.82
55 0.81
56 0.75
57 0.73
58 0.67
59 0.62
60 0.52
61 0.43
62 0.35
63 0.28
64 0.24
65 0.18
66 0.16
67 0.13
68 0.16
69 0.16
70 0.14
71 0.15
72 0.15
73 0.17
74 0.15
75 0.15