Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3AM42

Protein Details
Accession A0A2T3AM42   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
88-110LNSLHCHRRLSRKLKAESRRKARBasic
NLS Segment(s)
PositionSequence
96-110RLSRKLKAESRRKAR
Subcellular Location(s) plas 12, mito 9, extr 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR017384  NADH_Ub_cplx-1_asu_su-1  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0070469  C:respirasome  
Pfam View protein in Pfam  
PF15879  MWFE  
Amino Acid Sequences MPVPFETFLPYAIVFTMFGVTGAGVGFVKYKANGNKRARRSLDQWDRQMMNRDLRMTGHLRGQSDLPVAPPGYELSHPWRACREAHGLNSLHCHRRLSRKLKAESRRKAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.07
5 0.07
6 0.06
7 0.06
8 0.05
9 0.05
10 0.05
11 0.04
12 0.04
13 0.05
14 0.06
15 0.07
16 0.08
17 0.14
18 0.21
19 0.28
20 0.38
21 0.47
22 0.56
23 0.61
24 0.7
25 0.69
26 0.66
27 0.64
28 0.64
29 0.65
30 0.63
31 0.6
32 0.56
33 0.53
34 0.49
35 0.52
36 0.44
37 0.38
38 0.32
39 0.3
40 0.26
41 0.25
42 0.26
43 0.21
44 0.19
45 0.18
46 0.18
47 0.18
48 0.18
49 0.18
50 0.16
51 0.15
52 0.14
53 0.11
54 0.11
55 0.1
56 0.09
57 0.09
58 0.09
59 0.1
60 0.1
61 0.11
62 0.16
63 0.25
64 0.25
65 0.26
66 0.29
67 0.29
68 0.3
69 0.32
70 0.33
71 0.29
72 0.32
73 0.36
74 0.34
75 0.33
76 0.39
77 0.41
78 0.39
79 0.36
80 0.37
81 0.37
82 0.47
83 0.56
84 0.57
85 0.62
86 0.66
87 0.74
88 0.8
89 0.85
90 0.85