Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3AJ92

Protein Details
Accession A0A2T3AJ92    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
49-71IEDANGKKRRRRRVQPQEPTIKDBasic
NLS Segment(s)
PositionSequence
55-61KKRRRRR
Subcellular Location(s) extr 9, mito 6, plas 3, E.R. 3, golg 3, mito_nucl 3
Family & Domain DBs
Amino Acid Sequences MPPPHLHPRSRMTSSLFATTLFASFFVVALPHALPCPAPRVAYADGEIIEDANGKKRRRRRVQPQEPTIKDGIVQFDSLIQSDLVDQEGRSEKRECPVPKPGGKVGELLGFKKADNGTSSEGSKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.48
3 0.41
4 0.33
5 0.3
6 0.27
7 0.21
8 0.14
9 0.12
10 0.09
11 0.08
12 0.08
13 0.06
14 0.06
15 0.05
16 0.07
17 0.07
18 0.06
19 0.06
20 0.07
21 0.07
22 0.08
23 0.12
24 0.11
25 0.12
26 0.12
27 0.16
28 0.18
29 0.19
30 0.19
31 0.16
32 0.15
33 0.15
34 0.14
35 0.09
36 0.07
37 0.07
38 0.07
39 0.14
40 0.2
41 0.22
42 0.28
43 0.36
44 0.47
45 0.56
46 0.66
47 0.69
48 0.75
49 0.84
50 0.88
51 0.89
52 0.88
53 0.79
54 0.73
55 0.61
56 0.5
57 0.39
58 0.3
59 0.24
60 0.15
61 0.13
62 0.09
63 0.1
64 0.11
65 0.1
66 0.1
67 0.07
68 0.06
69 0.06
70 0.07
71 0.06
72 0.07
73 0.06
74 0.09
75 0.16
76 0.17
77 0.2
78 0.22
79 0.23
80 0.27
81 0.36
82 0.36
83 0.35
84 0.44
85 0.5
86 0.52
87 0.56
88 0.56
89 0.51
90 0.49
91 0.45
92 0.37
93 0.35
94 0.32
95 0.27
96 0.26
97 0.22
98 0.21
99 0.25
100 0.24
101 0.2
102 0.21
103 0.24
104 0.25
105 0.28