Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2ZZP1

Protein Details
Accession A0A2T2ZZP1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
47-72EGHGTIRRRREREKERERKPGSSKRABasic
NLS Segment(s)
PositionSequence
52-81IRRRREREKERERKPGSSKRASRHGQREWK
Subcellular Location(s) mito 13.5, cyto_mito 9.5, extr 5, cyto 4.5, pero 2
Family & Domain DBs
Amino Acid Sequences MLWMLWKCLCVCVGCCARARERTCKRAKVVLLGAKEGEAAGAEAGAEGHGTIRRRREREKERERKPGSSKRASRHGQREWK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.31
3 0.33
4 0.37
5 0.44
6 0.47
7 0.5
8 0.54
9 0.62
10 0.66
11 0.69
12 0.68
13 0.66
14 0.63
15 0.58
16 0.56
17 0.51
18 0.44
19 0.38
20 0.34
21 0.26
22 0.25
23 0.18
24 0.11
25 0.05
26 0.04
27 0.03
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.03
36 0.06
37 0.08
38 0.12
39 0.21
40 0.29
41 0.35
42 0.43
43 0.53
44 0.61
45 0.7
46 0.79
47 0.81
48 0.82
49 0.87
50 0.85
51 0.83
52 0.82
53 0.81
54 0.79
55 0.79
56 0.78
57 0.75
58 0.8
59 0.78
60 0.79
61 0.79