Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q7S8E8

Protein Details
Accession Q7S8E8    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
22-52VLTTEKRASEQKRKWKWKWKWKLSCGREKAEHydrophilic
NLS Segment(s)
PositionSequence
29-43ASEQKRKWKWKWKWK
181-185RAPKR
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
KEGG ncr:NCU08822  -  
Amino Acid Sequences MAVEGGSEVPWKKACCQGKRAVLTTEKRASEQKRKWKWKWKWKLSCGREKAEVGRLKENGGCWLARDRKRGDEEPQTVLFSPVCDVGKIRKGSRLDSSREEGKKMETPDGKWRELRNIACSKKCGFAGREMESCRQKDSSWSCSHTVRLGELSEVAREIGAVASRGSQDPAMHGRPSGGGRAPKRRWSLMVRARFWGRQGYGPIDWPTEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.45
3 0.52
4 0.58
5 0.63
6 0.68
7 0.68
8 0.65
9 0.64
10 0.62
11 0.62
12 0.6
13 0.52
14 0.48
15 0.53
16 0.56
17 0.58
18 0.62
19 0.65
20 0.68
21 0.78
22 0.85
23 0.88
24 0.9
25 0.91
26 0.93
27 0.93
28 0.93
29 0.92
30 0.94
31 0.92
32 0.91
33 0.87
34 0.8
35 0.74
36 0.65
37 0.59
38 0.57
39 0.53
40 0.46
41 0.46
42 0.41
43 0.38
44 0.37
45 0.33
46 0.28
47 0.24
48 0.2
49 0.15
50 0.23
51 0.3
52 0.34
53 0.39
54 0.39
55 0.44
56 0.51
57 0.53
58 0.5
59 0.51
60 0.49
61 0.48
62 0.46
63 0.4
64 0.34
65 0.31
66 0.25
67 0.16
68 0.13
69 0.11
70 0.1
71 0.09
72 0.09
73 0.12
74 0.19
75 0.22
76 0.22
77 0.25
78 0.26
79 0.29
80 0.36
81 0.38
82 0.35
83 0.36
84 0.39
85 0.41
86 0.4
87 0.39
88 0.31
89 0.29
90 0.29
91 0.27
92 0.29
93 0.23
94 0.25
95 0.33
96 0.38
97 0.37
98 0.36
99 0.36
100 0.36
101 0.4
102 0.39
103 0.37
104 0.4
105 0.43
106 0.41
107 0.43
108 0.38
109 0.35
110 0.36
111 0.32
112 0.25
113 0.28
114 0.32
115 0.33
116 0.35
117 0.35
118 0.39
119 0.41
120 0.4
121 0.35
122 0.3
123 0.26
124 0.31
125 0.33
126 0.35
127 0.35
128 0.38
129 0.38
130 0.39
131 0.4
132 0.35
133 0.31
134 0.24
135 0.21
136 0.17
137 0.15
138 0.16
139 0.15
140 0.12
141 0.11
142 0.1
143 0.08
144 0.07
145 0.07
146 0.06
147 0.06
148 0.06
149 0.06
150 0.07
151 0.09
152 0.09
153 0.1
154 0.11
155 0.11
156 0.14
157 0.2
158 0.22
159 0.21
160 0.21
161 0.2
162 0.22
163 0.23
164 0.23
165 0.23
166 0.28
167 0.34
168 0.45
169 0.5
170 0.55
171 0.6
172 0.6
173 0.61
174 0.6
175 0.64
176 0.63
177 0.67
178 0.61
179 0.62
180 0.63
181 0.59
182 0.55
183 0.52
184 0.45
185 0.41
186 0.42
187 0.41
188 0.38
189 0.41
190 0.41