Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3AGW3

Protein Details
Accession A0A2T3AGW3    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
78-101GRGFGPGRRGRRRRRFARTCENLRBasic
155-179LPESCCTKKRNCLRGRLKTRTRLTAHydrophilic
NLS Segment(s)
PositionSequence
83-93PGRRGRRRRRF
Subcellular Location(s) nucl 14, mito 11, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MLLKQVDKTRIPAQHRSSNRSTSCSLERQAASLVFLAAAQLQLHRRRSRFLASLQAQREPPNGPVWLAERTPSNELCGRGFGPGRRGRRRRRFARTCENLRGLEGASGRPYKKLMASGVPLEPSLRHKPAVISTTPSQADACGGCNAPGSPSPYLPESCCTKKRNCLRGRLKTRTRLTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.67
3 0.69
4 0.67
5 0.68
6 0.65
7 0.6
8 0.55
9 0.51
10 0.5
11 0.48
12 0.43
13 0.41
14 0.38
15 0.35
16 0.35
17 0.3
18 0.25
19 0.2
20 0.17
21 0.11
22 0.1
23 0.09
24 0.06
25 0.06
26 0.05
27 0.07
28 0.13
29 0.2
30 0.28
31 0.33
32 0.34
33 0.38
34 0.42
35 0.46
36 0.44
37 0.41
38 0.44
39 0.43
40 0.49
41 0.47
42 0.46
43 0.41
44 0.39
45 0.38
46 0.29
47 0.26
48 0.21
49 0.2
50 0.16
51 0.16
52 0.17
53 0.18
54 0.16
55 0.15
56 0.14
57 0.16
58 0.19
59 0.18
60 0.18
61 0.18
62 0.19
63 0.19
64 0.18
65 0.16
66 0.15
67 0.17
68 0.15
69 0.2
70 0.26
71 0.34
72 0.42
73 0.51
74 0.59
75 0.69
76 0.78
77 0.79
78 0.84
79 0.85
80 0.83
81 0.85
82 0.84
83 0.79
84 0.76
85 0.69
86 0.59
87 0.5
88 0.42
89 0.31
90 0.24
91 0.18
92 0.12
93 0.12
94 0.15
95 0.15
96 0.15
97 0.16
98 0.15
99 0.15
100 0.18
101 0.17
102 0.17
103 0.19
104 0.21
105 0.21
106 0.2
107 0.19
108 0.17
109 0.16
110 0.18
111 0.22
112 0.21
113 0.21
114 0.21
115 0.23
116 0.28
117 0.31
118 0.26
119 0.26
120 0.26
121 0.31
122 0.3
123 0.29
124 0.24
125 0.2
126 0.2
127 0.15
128 0.16
129 0.12
130 0.12
131 0.11
132 0.13
133 0.13
134 0.13
135 0.15
136 0.17
137 0.17
138 0.18
139 0.2
140 0.22
141 0.24
142 0.23
143 0.25
144 0.28
145 0.34
146 0.41
147 0.44
148 0.48
149 0.56
150 0.65
151 0.72
152 0.72
153 0.75
154 0.79
155 0.84
156 0.88
157 0.89
158 0.88
159 0.87