Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3AFJ5

Protein Details
Accession A0A2T3AFJ5    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
91-121KYKTRYAKIQDKKTSGKKGHYKKVMARRKRGBasic
NLS Segment(s)
PositionSequence
100-121QDKKTSGKKGHYKKVMARRKRG
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039883  Fcf2/DNTTIP2  
IPR014810  Fcf2_C  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF08698  Fcf2  
Amino Acid Sequences DNAGANWNNMPRTKIEDPKVKREFQLLRMRGILDAKKHFKKDNRKDPFPQYSKMGTLIEGPTEYYSARVNRKDRKQTLVEEVLASAEANNKYKTRYAKIQDKKTSGKKGHYKKVMARRKRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.46
3 0.53
4 0.57
5 0.66
6 0.7
7 0.65
8 0.59
9 0.59
10 0.56
11 0.55
12 0.6
13 0.51
14 0.47
15 0.46
16 0.45
17 0.38
18 0.37
19 0.31
20 0.26
21 0.32
22 0.37
23 0.42
24 0.45
25 0.5
26 0.54
27 0.62
28 0.68
29 0.71
30 0.72
31 0.73
32 0.76
33 0.78
34 0.79
35 0.72
36 0.64
37 0.56
38 0.49
39 0.43
40 0.39
41 0.3
42 0.2
43 0.18
44 0.16
45 0.12
46 0.1
47 0.09
48 0.07
49 0.08
50 0.07
51 0.06
52 0.08
53 0.12
54 0.17
55 0.23
56 0.3
57 0.38
58 0.48
59 0.57
60 0.58
61 0.61
62 0.6
63 0.57
64 0.58
65 0.53
66 0.45
67 0.34
68 0.31
69 0.24
70 0.2
71 0.16
72 0.09
73 0.1
74 0.11
75 0.14
76 0.16
77 0.17
78 0.19
79 0.24
80 0.3
81 0.32
82 0.39
83 0.45
84 0.54
85 0.63
86 0.72
87 0.75
88 0.77
89 0.79
90 0.79
91 0.81
92 0.77
93 0.77
94 0.77
95 0.78
96 0.82
97 0.81
98 0.8
99 0.79
100 0.84
101 0.84