Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2ZS93

Protein Details
Accession A0A2T2ZS93    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
25-60SSGQSRCSSRPRKEKEKEKEKRKRKKDRPSKSAFITBasic
NLS Segment(s)
PositionSequence
34-55RPRKEKEKEKEKRKRKKDRPSK
Subcellular Location(s) mito 11, extr 8, plas 3, nucl 2, pero 2
Family & Domain DBs
Amino Acid Sequences MRIWVAFLVSFLLASATTIATTVSSSGQSRCSSRPRKEKEKEKEKRKRKKDRPSKSAFITNWHWHVPSGPCATPHLSKRCQPRAQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.05
5 0.05
6 0.05
7 0.05
8 0.05
9 0.06
10 0.06
11 0.08
12 0.09
13 0.1
14 0.14
15 0.15
16 0.18
17 0.22
18 0.31
19 0.38
20 0.46
21 0.56
22 0.6
23 0.7
24 0.76
25 0.82
26 0.83
27 0.85
28 0.86
29 0.87
30 0.89
31 0.89
32 0.91
33 0.91
34 0.92
35 0.91
36 0.92
37 0.92
38 0.93
39 0.92
40 0.9
41 0.86
42 0.79
43 0.77
44 0.66
45 0.61
46 0.57
47 0.52
48 0.46
49 0.41
50 0.37
51 0.29
52 0.32
53 0.29
54 0.28
55 0.28
56 0.26
57 0.26
58 0.29
59 0.33
60 0.35
61 0.4
62 0.43
63 0.43
64 0.48
65 0.58
66 0.65