Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3AEG0

Protein Details
Accession A0A2T3AEG0   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
30-51TESAPRLRRGQRRLRRLQRLLCHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 11, plas 6, E.R. 5, mito 3
Family & Domain DBs
Amino Acid Sequences MMVVVVVVVVMAVAVDDCGDLGTAPPSQPTESAPRLRRGQRRLRRLQRLLCTLRHCSVGAAHMAGSSRASGQEGERLGCWVRQRGNLVDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.02
3 0.02
4 0.02
5 0.03
6 0.03
7 0.03
8 0.04
9 0.06
10 0.06
11 0.07
12 0.08
13 0.09
14 0.1
15 0.11
16 0.13
17 0.18
18 0.23
19 0.31
20 0.33
21 0.38
22 0.44
23 0.51
24 0.56
25 0.58
26 0.64
27 0.65
28 0.72
29 0.77
30 0.8
31 0.82
32 0.81
33 0.79
34 0.74
35 0.74
36 0.67
37 0.61
38 0.55
39 0.49
40 0.44
41 0.39
42 0.33
43 0.25
44 0.22
45 0.19
46 0.15
47 0.12
48 0.1
49 0.09
50 0.09
51 0.09
52 0.08
53 0.07
54 0.07
55 0.07
56 0.08
57 0.08
58 0.09
59 0.14
60 0.15
61 0.16
62 0.16
63 0.18
64 0.18
65 0.2
66 0.23
67 0.25
68 0.28
69 0.33
70 0.37