FuNGI

A0A2P7YHZ5

Protein Details

Accession

A0A2P7YHZ5

Localization Confidence

Medium

Confidence Score

10.7

NoLS Segment(s)

Position	Sequence	Protein Nature
38-67	LREARQLAKKEKTQQGRKKVKKGGMTHHFF	Hydrophilic

NLS Segment(s)

Position	Sequence
32-60	KKARQALREARQLAKKEKTQQGRKKVKKG

Subcellular Location(s)

mito 17, nucl 7, cyto 2

Family & Domain DBs

InterPro	View protein in InterPro IPR027417 P-loop_NTPase IPR019368 Ribosomal_S23/S29_mit IPR017082 Ribosomal_S23_mit_fun
Gene Ontology	GO:0005763 C:mitochondrial small ribosomal subunit GO:0032543 P:mitochondrial translation
Pfam	View protein in Pfam PF10236 DAP3

Amino Acid Sequences

MLPVRQSWGLSVHARTLSSYAPLALLRETLSKKARQALREARQLAKKEKTQQGRKKVKKGGMTHHFFRDAVSVLRSENKIQPLENLGVTPLEAGDMENESIVSYNQASLPLLKGLNVFKRYQHHELFESPISVVSLNTRLLLDNVLNEAKNTKENRHFLRGERGVGKSTLLAQAHALAYSKYKGDVVMLHFESPENIVNGTSNYVFNKEKGVFQQPMFTKRWIGKTRFVNEKVFRKMPLTKDIEVSTEKSSFKLKKDSNTVYDFLLRSRDFAKATSAFDLLWEQLQHHSEKFPVICTIDNFNGLISKPFTEYRHTNYTPIHLTEFEMGNYLLDLVTGDLSFKKGAVIACGSSAHANTKTLTVGLGLEEYDPYSRKAECDKIIAQRLLKNGKIPVVNVKNLTPEEARSLVLFYGQAGVLKVRDYPYKETIAMPEDTSSASLMKLVGALPQVIDAEYQFERLIKSTFNVSQGNPGHLLKAAAFDC

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.29
2	0.28
3	0.27
4	0.24
5	0.22
6	0.21
7	0.16
8	0.15
9	0.15
10	0.16
11	0.14
12	0.14
13	0.13
14	0.19
15	0.21
16	0.27
17	0.32
18	0.36
19	0.39
20	0.47
21	0.52
22	0.49
23	0.57
24	0.6
25	0.63
26	0.68
27	0.68
28	0.67
29	0.68
30	0.71
31	0.69
32	0.67
33	0.65
34	0.66
35	0.71
36	0.74
37	0.78
38	0.81
39	0.83
40	0.86
41	0.89
42	0.89
43	0.89
44	0.85
45	0.83
46	0.81
47	0.81
48	0.8
49	0.78
50	0.72
51	0.69
52	0.64
53	0.55
54	0.48
55	0.4
56	0.32
57	0.26
58	0.23
59	0.18
60	0.17
61	0.23
62	0.24
63	0.24
64	0.28
65	0.31
66	0.31
67	0.31
68	0.32
69	0.31
70	0.32
71	0.28
72	0.23
73	0.18
74	0.16
75	0.15
76	0.13
77	0.08
78	0.06
79	0.05
80	0.05
81	0.06
82	0.07
83	0.07
84	0.07
85	0.07
86	0.07
87	0.07
88	0.07
89	0.07
90	0.06
91	0.07
92	0.08
93	0.09
94	0.09
95	0.1
96	0.11
97	0.12
98	0.12
99	0.12
100	0.14
101	0.18
102	0.25
103	0.27
104	0.27
105	0.29
106	0.36
107	0.42
108	0.47
109	0.46
110	0.43
111	0.42
112	0.44
113	0.44
114	0.38
115	0.32
116	0.24
117	0.21
118	0.18
119	0.14
120	0.12
121	0.09
122	0.11
123	0.1
124	0.11
125	0.11
126	0.11
127	0.11
128	0.12
129	0.1
130	0.09
131	0.11
132	0.12
133	0.12
134	0.11
135	0.12
136	0.12
137	0.18
138	0.2
139	0.24
140	0.31
141	0.38
142	0.43
143	0.5
144	0.51
145	0.48
146	0.56
147	0.52
148	0.48
149	0.46
150	0.41
151	0.35
152	0.33
153	0.3
154	0.2
155	0.19
156	0.19
157	0.15
158	0.14
159	0.12
160	0.14
161	0.14
162	0.14
163	0.12
164	0.08
165	0.09
166	0.1
167	0.1
168	0.08
169	0.08
170	0.08
171	0.09
172	0.12
173	0.13
174	0.18
175	0.18
176	0.18
177	0.18
178	0.18
179	0.17
180	0.15
181	0.14
182	0.08
183	0.08
184	0.07
185	0.08
186	0.08
187	0.09
188	0.09
189	0.09
190	0.09
191	0.12
192	0.13
193	0.13
194	0.17
195	0.16
196	0.17
197	0.2
198	0.25
199	0.24
200	0.24
201	0.31
202	0.29
203	0.33
204	0.34
205	0.31
206	0.29
207	0.3
208	0.38
209	0.38
210	0.4
211	0.42
212	0.47
213	0.52
214	0.57
215	0.57
216	0.55
217	0.54
218	0.57
219	0.55
220	0.49
221	0.44
222	0.39
223	0.41
224	0.37
225	0.4
226	0.38
227	0.33
228	0.34
229	0.33
230	0.32
231	0.28
232	0.27
233	0.2
234	0.19
235	0.18
236	0.17
237	0.22
238	0.23
239	0.25
240	0.32
241	0.32
242	0.35
243	0.43
244	0.46
245	0.45
246	0.45
247	0.43
248	0.35
249	0.35
250	0.3
251	0.22
252	0.23
253	0.18
254	0.16
255	0.16
256	0.18
257	0.16
258	0.16
259	0.2
260	0.17
261	0.18
262	0.19
263	0.18
264	0.15
265	0.15
266	0.15
267	0.11
268	0.1
269	0.08
270	0.07
271	0.1
272	0.12
273	0.12
274	0.12
275	0.13
276	0.12
277	0.15
278	0.15
279	0.13
280	0.14
281	0.14
282	0.14
283	0.15
284	0.18
285	0.16
286	0.16
287	0.15
288	0.13
289	0.13
290	0.12
291	0.13
292	0.1
293	0.1
294	0.11
295	0.14
296	0.16
297	0.2
298	0.23
299	0.28
300	0.36
301	0.36
302	0.37
303	0.35
304	0.38
305	0.35
306	0.33
307	0.29
308	0.2
309	0.21
310	0.2
311	0.2
312	0.15
313	0.14
314	0.12
315	0.1
316	0.1
317	0.09
318	0.05
319	0.05
320	0.05
321	0.04
322	0.04
323	0.04
324	0.05
325	0.05
326	0.06
327	0.07
328	0.06
329	0.06
330	0.08
331	0.09
332	0.11
333	0.12
334	0.11
335	0.12
336	0.13
337	0.13
338	0.12
339	0.12
340	0.14
341	0.13
342	0.14
343	0.14
344	0.14
345	0.14
346	0.13
347	0.12
348	0.09
349	0.08
350	0.08
351	0.07
352	0.07
353	0.06
354	0.07
355	0.07
356	0.08
357	0.09
358	0.11
359	0.12
360	0.13
361	0.15
362	0.2
363	0.26
364	0.27
365	0.32
366	0.36
367	0.41
368	0.48
369	0.5
370	0.47
371	0.44
372	0.49
373	0.48
374	0.45
375	0.41
376	0.36
377	0.38
378	0.36
379	0.34
380	0.37
381	0.38
382	0.4
383	0.38
384	0.36
385	0.36
386	0.35
387	0.38
388	0.29
389	0.24
390	0.25
391	0.24
392	0.23
393	0.18
394	0.19
395	0.15
396	0.15
397	0.13
398	0.09
399	0.1
400	0.09
401	0.1
402	0.09
403	0.11
404	0.1
405	0.11
406	0.13
407	0.14
408	0.2
409	0.24
410	0.29
411	0.33
412	0.36
413	0.37
414	0.37
415	0.37
416	0.36
417	0.33
418	0.27
419	0.23
420	0.2
421	0.19
422	0.18
423	0.15
424	0.11
425	0.1
426	0.1
427	0.09
428	0.08
429	0.08
430	0.08
431	0.1
432	0.1
433	0.11
434	0.1
435	0.11
436	0.11
437	0.1
438	0.11
439	0.08
440	0.11
441	0.12
442	0.13
443	0.12
444	0.13
445	0.14
446	0.16
447	0.18
448	0.15
449	0.17
450	0.22
451	0.25
452	0.29
453	0.31
454	0.3
455	0.38
456	0.39
457	0.41
458	0.38
459	0.35
460	0.31
461	0.28
462	0.29
463	0.2

A0A2P7YHZ5

3D AlphaFold-predicted Structure Viewer