Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P7YCZ0

Protein Details
Accession A0A2P7YCZ0    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
266-295GYFHGREKQKAQKKESGRKRAYHRNRLVVDBasic
NLS Segment(s)
PositionSequence
271-286REKQKAQKKESGRKRA
Subcellular Location(s) nucl 13, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
Amino Acid Sequences MNFLATPHAQVCRIYKEERYGDQSYCELLIPFVLRHPKDLIWWSIWTFESIRQSCGYRCCDYIRKYVKDVDEGAAYLESLPEQDRIPIKRNADKVCAELLNNGIRASFLPPNLDDTLCLFKRMYDEVSKVPAMLYTDLLIHWKKKDEQLDHAHAHPAIVLAFCHTHLVEPMFKVLMVLRPRLKGDFVSFIDAEFQRRGIERMDIKSLYFDNYQEMFIYPCDLEQAGPFRVFSWEEPSALSKRHFIKCTHCHKKVQIVDGFGAKRTGYFHGREKQKAQKKESGRKRAYHRNRLVVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.37
3 0.43
4 0.47
5 0.49
6 0.52
7 0.49
8 0.46
9 0.45
10 0.41
11 0.34
12 0.29
13 0.24
14 0.17
15 0.13
16 0.14
17 0.13
18 0.12
19 0.16
20 0.24
21 0.24
22 0.26
23 0.29
24 0.28
25 0.32
26 0.36
27 0.34
28 0.29
29 0.31
30 0.29
31 0.28
32 0.28
33 0.25
34 0.22
35 0.22
36 0.29
37 0.28
38 0.29
39 0.28
40 0.3
41 0.32
42 0.37
43 0.38
44 0.31
45 0.32
46 0.36
47 0.42
48 0.44
49 0.51
50 0.54
51 0.52
52 0.53
53 0.57
54 0.53
55 0.49
56 0.47
57 0.38
58 0.3
59 0.26
60 0.23
61 0.17
62 0.14
63 0.1
64 0.08
65 0.06
66 0.05
67 0.07
68 0.07
69 0.07
70 0.11
71 0.16
72 0.19
73 0.25
74 0.29
75 0.33
76 0.38
77 0.45
78 0.45
79 0.45
80 0.43
81 0.4
82 0.39
83 0.35
84 0.29
85 0.23
86 0.22
87 0.19
88 0.18
89 0.16
90 0.12
91 0.11
92 0.12
93 0.14
94 0.14
95 0.12
96 0.13
97 0.13
98 0.18
99 0.19
100 0.18
101 0.15
102 0.15
103 0.21
104 0.19
105 0.2
106 0.16
107 0.16
108 0.18
109 0.19
110 0.19
111 0.15
112 0.18
113 0.18
114 0.21
115 0.2
116 0.18
117 0.16
118 0.14
119 0.13
120 0.11
121 0.1
122 0.07
123 0.07
124 0.07
125 0.1
126 0.1
127 0.11
128 0.11
129 0.14
130 0.15
131 0.2
132 0.27
133 0.27
134 0.33
135 0.38
136 0.43
137 0.42
138 0.41
139 0.37
140 0.3
141 0.27
142 0.2
143 0.13
144 0.08
145 0.06
146 0.05
147 0.05
148 0.05
149 0.06
150 0.06
151 0.06
152 0.06
153 0.07
154 0.09
155 0.09
156 0.09
157 0.1
158 0.09
159 0.09
160 0.09
161 0.09
162 0.12
163 0.13
164 0.18
165 0.19
166 0.21
167 0.23
168 0.24
169 0.24
170 0.2
171 0.2
172 0.22
173 0.2
174 0.22
175 0.21
176 0.2
177 0.23
178 0.22
179 0.21
180 0.16
181 0.15
182 0.12
183 0.13
184 0.15
185 0.12
186 0.18
187 0.2
188 0.22
189 0.27
190 0.26
191 0.25
192 0.26
193 0.25
194 0.23
195 0.19
196 0.17
197 0.17
198 0.17
199 0.17
200 0.16
201 0.16
202 0.13
203 0.12
204 0.14
205 0.1
206 0.08
207 0.09
208 0.09
209 0.09
210 0.1
211 0.14
212 0.14
213 0.15
214 0.15
215 0.14
216 0.16
217 0.18
218 0.17
219 0.2
220 0.19
221 0.19
222 0.21
223 0.24
224 0.24
225 0.25
226 0.26
227 0.25
228 0.31
229 0.38
230 0.41
231 0.41
232 0.49
233 0.55
234 0.65
235 0.7
236 0.68
237 0.68
238 0.7
239 0.76
240 0.72
241 0.71
242 0.64
243 0.57
244 0.53
245 0.52
246 0.48
247 0.39
248 0.34
249 0.25
250 0.21
251 0.21
252 0.24
253 0.22
254 0.26
255 0.34
256 0.42
257 0.5
258 0.56
259 0.61
260 0.67
261 0.71
262 0.76
263 0.75
264 0.75
265 0.78
266 0.82
267 0.85
268 0.85
269 0.84
270 0.83
271 0.85
272 0.87
273 0.87
274 0.88
275 0.86