Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P7YXG1

Protein Details
Accession A0A2P7YXG1   
Localization Confidence High
Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
46-70ILPDNIKKLKPKSVKQQKKTLPTILHydrophilic
149-186KKLKLKLNLKPKDKKGKKQAPAKPKTPKKPKVERYSSYBasic
NLS Segment(s)
PositionSequence
148-179QKKLKLKLNLKPKDKKGKKQAPAKPKTPKKPK
Subcellular Location(s) nucl 18, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR035503  IOC4-like_PWWP  
IPR000313  PWWP_dom  
Pfam View protein in Pfam  
PF00855  PWWP  
PROSITE View protein in PROSITE  
PS50812  PWWP  
CDD cd05840  PWWP_ScIOC4-like  
Amino Acid Sequences MPEAEQMEAKSDLTLQEELGLAPRTIVLAKVKGYRAWPAMVLDEEILPDNIKKLKPKSVKQQKKTLPTILVPVRFFSDDTYIWIRNHDLKVLLDNDIQLFLDKHSTAGKKKDELLVFAYELAQNPPDMNEFNLWGSRGPPDLDPEPPQKKLKLKLNLKPKDKKGKKQAPAKPKTPKKPKVERYSSYEEYEKDLENASEPENDEYGSDWGLNDSVFDFETGDYVFDDEKEQNAFVSEFPTSAELQENSAYYNEQFEIIFQKVAPALLDGEISNENTINKELRAAGKLAQEAPLAVFTKSPLYRSLLVAAHKPEEKLPSKSVKSTIANLLKNFSLETCTLTMEDLVLPTPQETPNQTPGLTPGPENGIKQESEAAAEVQESDSNGQEQRDASEAAKTSTESVDLVSDVAHPNETAESTAVAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.13
3 0.14
4 0.14
5 0.14
6 0.16
7 0.17
8 0.13
9 0.13
10 0.13
11 0.12
12 0.12
13 0.15
14 0.16
15 0.17
16 0.22
17 0.28
18 0.3
19 0.33
20 0.35
21 0.39
22 0.37
23 0.36
24 0.33
25 0.29
26 0.29
27 0.27
28 0.25
29 0.19
30 0.16
31 0.15
32 0.14
33 0.13
34 0.11
35 0.11
36 0.13
37 0.18
38 0.21
39 0.28
40 0.32
41 0.42
42 0.51
43 0.59
44 0.67
45 0.73
46 0.81
47 0.81
48 0.87
49 0.85
50 0.85
51 0.84
52 0.79
53 0.72
54 0.63
55 0.64
56 0.6
57 0.56
58 0.47
59 0.41
60 0.37
61 0.33
62 0.31
63 0.25
64 0.23
65 0.17
66 0.22
67 0.26
68 0.26
69 0.25
70 0.26
71 0.27
72 0.3
73 0.3
74 0.28
75 0.25
76 0.22
77 0.27
78 0.27
79 0.26
80 0.2
81 0.2
82 0.18
83 0.17
84 0.16
85 0.12
86 0.11
87 0.09
88 0.12
89 0.11
90 0.12
91 0.17
92 0.22
93 0.26
94 0.33
95 0.37
96 0.37
97 0.4
98 0.46
99 0.41
100 0.39
101 0.37
102 0.32
103 0.27
104 0.24
105 0.22
106 0.16
107 0.16
108 0.14
109 0.11
110 0.09
111 0.09
112 0.09
113 0.1
114 0.1
115 0.1
116 0.1
117 0.11
118 0.12
119 0.13
120 0.13
121 0.11
122 0.12
123 0.12
124 0.12
125 0.12
126 0.12
127 0.16
128 0.17
129 0.19
130 0.23
131 0.3
132 0.33
133 0.36
134 0.39
135 0.39
136 0.44
137 0.49
138 0.54
139 0.56
140 0.61
141 0.63
142 0.71
143 0.75
144 0.78
145 0.79
146 0.79
147 0.8
148 0.79
149 0.81
150 0.81
151 0.83
152 0.82
153 0.84
154 0.83
155 0.83
156 0.82
157 0.82
158 0.81
159 0.8
160 0.82
161 0.83
162 0.83
163 0.82
164 0.86
165 0.87
166 0.87
167 0.86
168 0.8
169 0.76
170 0.75
171 0.68
172 0.6
173 0.52
174 0.42
175 0.36
176 0.34
177 0.26
178 0.18
179 0.16
180 0.13
181 0.12
182 0.12
183 0.1
184 0.1
185 0.1
186 0.1
187 0.1
188 0.1
189 0.09
190 0.09
191 0.08
192 0.07
193 0.06
194 0.05
195 0.05
196 0.05
197 0.05
198 0.04
199 0.04
200 0.04
201 0.04
202 0.05
203 0.05
204 0.05
205 0.05
206 0.05
207 0.05
208 0.05
209 0.05
210 0.05
211 0.05
212 0.07
213 0.07
214 0.08
215 0.08
216 0.08
217 0.08
218 0.09
219 0.09
220 0.07
221 0.08
222 0.07
223 0.07
224 0.07
225 0.09
226 0.08
227 0.08
228 0.1
229 0.09
230 0.1
231 0.11
232 0.11
233 0.1
234 0.1
235 0.1
236 0.08
237 0.09
238 0.08
239 0.08
240 0.07
241 0.07
242 0.1
243 0.11
244 0.11
245 0.09
246 0.1
247 0.1
248 0.1
249 0.09
250 0.07
251 0.06
252 0.06
253 0.07
254 0.06
255 0.08
256 0.08
257 0.09
258 0.08
259 0.08
260 0.08
261 0.09
262 0.1
263 0.1
264 0.09
265 0.1
266 0.12
267 0.14
268 0.15
269 0.16
270 0.18
271 0.2
272 0.21
273 0.2
274 0.2
275 0.18
276 0.16
277 0.15
278 0.15
279 0.13
280 0.11
281 0.11
282 0.1
283 0.16
284 0.17
285 0.18
286 0.17
287 0.2
288 0.22
289 0.23
290 0.27
291 0.24
292 0.25
293 0.27
294 0.27
295 0.27
296 0.27
297 0.26
298 0.24
299 0.29
300 0.32
301 0.33
302 0.36
303 0.41
304 0.43
305 0.45
306 0.46
307 0.46
308 0.44
309 0.43
310 0.47
311 0.46
312 0.47
313 0.44
314 0.43
315 0.36
316 0.34
317 0.3
318 0.21
319 0.16
320 0.13
321 0.15
322 0.13
323 0.14
324 0.14
325 0.14
326 0.13
327 0.11
328 0.11
329 0.08
330 0.08
331 0.08
332 0.08
333 0.08
334 0.11
335 0.11
336 0.14
337 0.18
338 0.23
339 0.29
340 0.31
341 0.3
342 0.28
343 0.31
344 0.33
345 0.29
346 0.24
347 0.2
348 0.24
349 0.26
350 0.26
351 0.26
352 0.24
353 0.23
354 0.23
355 0.25
356 0.19
357 0.19
358 0.19
359 0.16
360 0.13
361 0.13
362 0.13
363 0.1
364 0.11
365 0.1
366 0.1
367 0.11
368 0.13
369 0.15
370 0.15
371 0.16
372 0.16
373 0.17
374 0.18
375 0.19
376 0.17
377 0.21
378 0.22
379 0.21
380 0.22
381 0.21
382 0.2
383 0.19
384 0.2
385 0.14
386 0.14
387 0.13
388 0.12
389 0.11
390 0.09
391 0.11
392 0.12
393 0.13
394 0.13
395 0.12
396 0.13
397 0.14
398 0.14
399 0.13
400 0.12