Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P7YX72

Protein Details
Accession A0A2P7YX72    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
3-24QRVTYRRKTPYNTKSNKIKVVKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MAQRVTYRRKTPYNTKSNKIKVVKTPGGKLVAQHLKKQATTPKCGDCGIALQGIATLRPREYSQISKTKKTVQRAYGGSRCANCVKERIVRAFLIEEQKIVKRVLKDQQEKEKASKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.79
3 0.81
4 0.81
5 0.82
6 0.77
7 0.73
8 0.7
9 0.72
10 0.71
11 0.65
12 0.61
13 0.56
14 0.54
15 0.48
16 0.4
17 0.4
18 0.41
19 0.39
20 0.4
21 0.41
22 0.4
23 0.4
24 0.44
25 0.43
26 0.38
27 0.42
28 0.42
29 0.39
30 0.39
31 0.38
32 0.34
33 0.26
34 0.23
35 0.18
36 0.14
37 0.1
38 0.08
39 0.09
40 0.08
41 0.08
42 0.07
43 0.06
44 0.06
45 0.07
46 0.08
47 0.1
48 0.13
49 0.18
50 0.23
51 0.32
52 0.36
53 0.39
54 0.41
55 0.47
56 0.5
57 0.53
58 0.54
59 0.49
60 0.52
61 0.53
62 0.58
63 0.53
64 0.5
65 0.45
66 0.39
67 0.38
68 0.34
69 0.32
70 0.26
71 0.26
72 0.27
73 0.31
74 0.34
75 0.35
76 0.35
77 0.33
78 0.33
79 0.32
80 0.31
81 0.31
82 0.27
83 0.24
84 0.23
85 0.26
86 0.27
87 0.26
88 0.26
89 0.24
90 0.31
91 0.38
92 0.46
93 0.53
94 0.59
95 0.69
96 0.73
97 0.74