Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P7YRU2

Protein Details
Accession A0A2P7YRU2   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
4-29TPGDRITTYKSRKRRLPYIHNSLTEKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039024  RTC4  
IPR028094  RTC4_C  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF14474  RTC4  
Amino Acid Sequences MSKTPGDRITTYKSRKRRLPYIHNSLTEKKPKPDDDGLIKLPAPKLKSEKSKPNFEDIDKILEKEPSSDKSIPSLYLLLPSNILEGNLDAEKPVKEKYKDSDFPLPKSQKSFKRRIDRLLPVIPRILAGDEELSFYYTLALEQRKESPHKTMLSSEQENVEWKRYIGGFYGLKRQHFVSRLIMARYGDELRRLANKTIVYWGPETFSTYVLANELLLRDVEKQKGLKFAEAERYLKDSIEYGCYVADGVRFDDDIEAGDVLGGKDGGEGKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.76
3 0.8
4 0.81
5 0.82
6 0.84
7 0.85
8 0.86
9 0.84
10 0.82
11 0.79
12 0.75
13 0.74
14 0.72
15 0.67
16 0.64
17 0.64
18 0.61
19 0.63
20 0.63
21 0.61
22 0.59
23 0.61
24 0.56
25 0.5
26 0.47
27 0.43
28 0.39
29 0.36
30 0.3
31 0.29
32 0.34
33 0.39
34 0.49
35 0.54
36 0.61
37 0.64
38 0.73
39 0.69
40 0.71
41 0.67
42 0.58
43 0.57
44 0.48
45 0.49
46 0.39
47 0.38
48 0.32
49 0.3
50 0.28
51 0.24
52 0.26
53 0.22
54 0.27
55 0.28
56 0.27
57 0.29
58 0.3
59 0.26
60 0.24
61 0.22
62 0.16
63 0.18
64 0.18
65 0.15
66 0.14
67 0.13
68 0.13
69 0.11
70 0.11
71 0.07
72 0.06
73 0.08
74 0.07
75 0.07
76 0.06
77 0.08
78 0.08
79 0.1
80 0.13
81 0.18
82 0.2
83 0.24
84 0.3
85 0.38
86 0.41
87 0.45
88 0.52
89 0.48
90 0.51
91 0.57
92 0.54
93 0.47
94 0.49
95 0.51
96 0.5
97 0.55
98 0.6
99 0.6
100 0.67
101 0.69
102 0.7
103 0.71
104 0.67
105 0.66
106 0.63
107 0.55
108 0.45
109 0.42
110 0.34
111 0.26
112 0.21
113 0.15
114 0.08
115 0.07
116 0.07
117 0.06
118 0.07
119 0.07
120 0.07
121 0.06
122 0.06
123 0.06
124 0.05
125 0.05
126 0.07
127 0.08
128 0.08
129 0.1
130 0.13
131 0.16
132 0.2
133 0.21
134 0.24
135 0.27
136 0.29
137 0.29
138 0.28
139 0.3
140 0.33
141 0.33
142 0.29
143 0.25
144 0.24
145 0.26
146 0.24
147 0.22
148 0.16
149 0.15
150 0.16
151 0.15
152 0.15
153 0.13
154 0.16
155 0.16
156 0.17
157 0.27
158 0.27
159 0.27
160 0.28
161 0.29
162 0.29
163 0.28
164 0.3
165 0.25
166 0.28
167 0.31
168 0.3
169 0.31
170 0.26
171 0.24
172 0.24
173 0.22
174 0.17
175 0.17
176 0.16
177 0.16
178 0.21
179 0.23
180 0.22
181 0.24
182 0.24
183 0.23
184 0.28
185 0.27
186 0.24
187 0.23
188 0.22
189 0.19
190 0.18
191 0.2
192 0.16
193 0.15
194 0.14
195 0.13
196 0.12
197 0.11
198 0.11
199 0.08
200 0.08
201 0.08
202 0.07
203 0.07
204 0.08
205 0.12
206 0.16
207 0.18
208 0.21
209 0.24
210 0.26
211 0.33
212 0.34
213 0.33
214 0.32
215 0.35
216 0.4
217 0.42
218 0.42
219 0.36
220 0.39
221 0.35
222 0.33
223 0.29
224 0.21
225 0.18
226 0.21
227 0.19
228 0.15
229 0.15
230 0.14
231 0.14
232 0.13
233 0.13
234 0.1
235 0.11
236 0.12
237 0.12
238 0.12
239 0.13
240 0.12
241 0.11
242 0.12
243 0.1
244 0.08
245 0.09
246 0.09
247 0.08
248 0.09
249 0.08
250 0.06
251 0.08