Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P7YZV2

Protein Details
Accession A0A2P7YZV2   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
342-365NDLSSMVKKRKAKPDESESKKPKKBasic
NLS Segment(s)
PositionSequence
349-365KKRKAKPDESESKKPKK
Subcellular Location(s) nucl 17, cyto_nucl 12.833, mito_nucl 9.333, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019544  Tetratricopeptide_SHNi-TPR_dom  
IPR011990  TPR-like_helical_dom_sf  
Pfam View protein in Pfam  
PF10516  SHNi-TPR  
Amino Acid Sequences MAYSETISQAIAEGAKLYAIKQYDEAATKYADACASYNEEHGEDDADLLLLYGKALFQSAVTRSGMLGGIGDNEEEQEEKEEEENDDGNFHFEDGIAPEVDDDENAEPEKEQDNEENEENEEAPQEQEEEAAPEQSDFEVAWEILELTRSLLDNKLEGESAEGLDTPYLKDADETTSSPYVATVKKLSEVYDLLGEVSLEAENFAQAATDLQSCLELRQKLYSADNGLVSECHYKLSLALEFSLADDLRAKATEQMKYAIESVKLRNTKETDEEKKKDNDILLRDMEERYKELKKSPKADLQAQQMDIIKGIMGEAVSGEGSSAAKAVQDLSNMVKKKPAVNDLSSMVKKRKAKPDESESKKPKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.09
3 0.09
4 0.09
5 0.13
6 0.14
7 0.15
8 0.15
9 0.18
10 0.21
11 0.24
12 0.25
13 0.22
14 0.22
15 0.22
16 0.21
17 0.2
18 0.17
19 0.15
20 0.14
21 0.14
22 0.18
23 0.18
24 0.19
25 0.19
26 0.19
27 0.18
28 0.18
29 0.17
30 0.12
31 0.12
32 0.1
33 0.08
34 0.07
35 0.07
36 0.07
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.1
46 0.12
47 0.15
48 0.15
49 0.16
50 0.15
51 0.16
52 0.16
53 0.11
54 0.1
55 0.07
56 0.08
57 0.08
58 0.08
59 0.06
60 0.06
61 0.07
62 0.07
63 0.07
64 0.09
65 0.09
66 0.1
67 0.12
68 0.13
69 0.13
70 0.15
71 0.15
72 0.12
73 0.13
74 0.12
75 0.12
76 0.11
77 0.1
78 0.08
79 0.07
80 0.08
81 0.08
82 0.1
83 0.08
84 0.08
85 0.08
86 0.09
87 0.08
88 0.07
89 0.08
90 0.07
91 0.08
92 0.09
93 0.09
94 0.08
95 0.1
96 0.12
97 0.12
98 0.13
99 0.15
100 0.18
101 0.21
102 0.23
103 0.22
104 0.2
105 0.2
106 0.18
107 0.15
108 0.12
109 0.09
110 0.08
111 0.07
112 0.08
113 0.07
114 0.07
115 0.07
116 0.09
117 0.09
118 0.09
119 0.09
120 0.08
121 0.08
122 0.08
123 0.08
124 0.05
125 0.05
126 0.06
127 0.05
128 0.05
129 0.05
130 0.05
131 0.05
132 0.06
133 0.05
134 0.04
135 0.05
136 0.06
137 0.07
138 0.08
139 0.09
140 0.09
141 0.1
142 0.1
143 0.09
144 0.09
145 0.09
146 0.08
147 0.07
148 0.07
149 0.06
150 0.05
151 0.06
152 0.06
153 0.05
154 0.05
155 0.05
156 0.05
157 0.06
158 0.06
159 0.09
160 0.1
161 0.11
162 0.13
163 0.13
164 0.13
165 0.13
166 0.12
167 0.12
168 0.11
169 0.12
170 0.11
171 0.11
172 0.13
173 0.14
174 0.14
175 0.13
176 0.13
177 0.12
178 0.11
179 0.11
180 0.08
181 0.08
182 0.07
183 0.05
184 0.05
185 0.04
186 0.03
187 0.04
188 0.03
189 0.03
190 0.03
191 0.03
192 0.03
193 0.03
194 0.03
195 0.04
196 0.05
197 0.05
198 0.05
199 0.06
200 0.06
201 0.08
202 0.12
203 0.12
204 0.13
205 0.15
206 0.16
207 0.17
208 0.19
209 0.2
210 0.17
211 0.17
212 0.16
213 0.15
214 0.14
215 0.12
216 0.12
217 0.13
218 0.11
219 0.1
220 0.1
221 0.09
222 0.1
223 0.13
224 0.13
225 0.11
226 0.11
227 0.11
228 0.1
229 0.11
230 0.12
231 0.09
232 0.08
233 0.08
234 0.09
235 0.09
236 0.09
237 0.1
238 0.14
239 0.18
240 0.21
241 0.21
242 0.23
243 0.23
244 0.24
245 0.25
246 0.22
247 0.2
248 0.2
249 0.22
250 0.27
251 0.3
252 0.3
253 0.35
254 0.35
255 0.36
256 0.4
257 0.46
258 0.48
259 0.54
260 0.57
261 0.56
262 0.58
263 0.57
264 0.53
265 0.48
266 0.44
267 0.39
268 0.4
269 0.36
270 0.34
271 0.33
272 0.31
273 0.3
274 0.25
275 0.24
276 0.23
277 0.27
278 0.28
279 0.34
280 0.42
281 0.48
282 0.52
283 0.57
284 0.6
285 0.61
286 0.66
287 0.66
288 0.65
289 0.62
290 0.57
291 0.52
292 0.46
293 0.41
294 0.33
295 0.26
296 0.17
297 0.11
298 0.1
299 0.08
300 0.05
301 0.05
302 0.04
303 0.05
304 0.05
305 0.05
306 0.05
307 0.05
308 0.05
309 0.05
310 0.05
311 0.05
312 0.05
313 0.06
314 0.08
315 0.09
316 0.1
317 0.12
318 0.17
319 0.25
320 0.27
321 0.27
322 0.3
323 0.31
324 0.36
325 0.41
326 0.45
327 0.44
328 0.46
329 0.49
330 0.48
331 0.54
332 0.52
333 0.51
334 0.48
335 0.49
336 0.53
337 0.58
338 0.66
339 0.66
340 0.71
341 0.75
342 0.8
343 0.83
344 0.84
345 0.86