FuNGI

A0A2P7YTS3

Protein Details

Accession

A0A2P7YTS3

Localization Confidence

Medium

Confidence Score

13.5

NoLS Segment(s)

Position	Sequence	Protein Nature
78-107	DTYLLKVPKDKLKNKPKKKTGRTNNVAEAY	Hydrophilic

NLS Segment(s)

Position	Sequence
85-98	PKDKLKNKPKKKTG
174-189	KKGRPLPKARRRGGLR

Subcellular Location(s)

nucl 15.5, mito_nucl 11.833, mito 7, cyto_mito 5.833, cyto 3.5

Family & Domain DBs

InterPro	View protein in InterPro IPR001884 IF5A-like IPR035503 IOC4-like_PWWP IPR012340 NA-bd_OB-fold IPR000313 PWWP_dom IPR014722 Rib_L2_dom2 IPR035441 TFIIS/LEDGF_dom_sf IPR017923 TFIIS_N IPR019769 Trans_elong_IF5A_hypusine_site IPR020189 Transl_elong_IF5A_C IPR008991 Translation_prot_SH3-like_sf
Gene Ontology	GO:0043022 F:ribosome binding GO:0003723 F:RNA binding GO:0003746 F:translation elongation factor activity GO:0003743 F:translation initiation factor activity GO:0045901 P:positive regulation of translational elongation GO:0045905 P:positive regulation of translational termination
Pfam	View protein in Pfam PF01287 eIF-5a PF08711 Med26 PF00855 PWWP
PROSITE	View protein in PROSITE PS00302 IF5A_HYPUSINE PS50812 PWWP
CDD	cd05840 PWWP_ScIOC4-like cd04468 S1_eIF5A

Amino Acid Sequences

MPPRKSAKTEFEPKALVLSKMTGFPAWPSFVMPSDMIPPAIMKAKKKTTNTCVIFIPDGDFNWMNEKGLELLTPAKLDTYLLKVPKDKLKNKPKKKTGRTNNVAEAYIAAKGLQFDEFMDELAAVNKGVAGENDDEDDEEEEDEVDETGEAEDAHDNDDAANNSIEHESDTDSKKGRPLPKARRRGGLRSSSRNGNGNAQSTLEEEPIEDEKDSDEESDSSRSRKRTRGTASSAPPKKRVVSNSSVTEETNGSGNGNGRSASPKPISEKDRQHQLWLCRIKLQRSLIQRNQPVTPKDPKQFPPPTVDELLVARLILHRLADFPLNVELLRETKIHKVLKCILKDEDLAYEESFKLHEKCNELLDKWKDMIESLKLEKQAKYESRLSSQAPEDTEITPKSLKGEDAEKHVFETADAGAALTFPMQCSALRKNGHVVIKGRPCKIVDMSTSKTGKHGHAKVHLVAIDIFTGKKLEDLSPSTHNMEVPNVSRQDYQLLDIDDGFLSLMTADGDTKDDVKVPEGDIGDKIQNDFDDGKDLIISVISAMGEEAAISHKEAPKGA

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.55
2	0.48
3	0.4
4	0.31
5	0.29
6	0.26
7	0.26
8	0.27
9	0.2
10	0.18
11	0.2
12	0.22
13	0.21
14	0.2
15	0.2
16	0.2
17	0.21
18	0.24
19	0.21
20	0.18
21	0.19
22	0.2
23	0.18
24	0.17
25	0.16
26	0.15
27	0.23
28	0.25
29	0.27
30	0.35
31	0.45
32	0.53
33	0.61
34	0.68
35	0.68
36	0.75
37	0.73
38	0.67
39	0.6
40	0.56
41	0.49
42	0.4
43	0.34
44	0.25
45	0.21
46	0.24
47	0.22
48	0.18
49	0.22
50	0.22
51	0.2
52	0.18
53	0.19
54	0.15
55	0.14
56	0.14
57	0.1
58	0.12
59	0.13
60	0.13
61	0.12
62	0.12
63	0.11
64	0.12
65	0.13
66	0.16
67	0.2
68	0.23
69	0.27
70	0.31
71	0.36
72	0.45
73	0.53
74	0.55
75	0.6
76	0.68
77	0.76
78	0.83
79	0.89
80	0.9
81	0.91
82	0.94
83	0.94
84	0.94
85	0.94
86	0.91
87	0.87
88	0.85
89	0.76
90	0.66
91	0.55
92	0.45
93	0.34
94	0.27
95	0.19
96	0.11
97	0.08
98	0.08
99	0.09
100	0.08
101	0.07
102	0.07
103	0.11
104	0.11
105	0.1
106	0.1
107	0.09
108	0.09
109	0.1
110	0.1
111	0.06
112	0.05
113	0.06
114	0.06
115	0.06
116	0.06
117	0.08
118	0.09
119	0.1
120	0.11
121	0.11
122	0.11
123	0.11
124	0.12
125	0.1
126	0.08
127	0.08
128	0.07
129	0.07
130	0.07
131	0.06
132	0.05
133	0.05
134	0.05
135	0.05
136	0.05
137	0.05
138	0.05
139	0.06
140	0.07
141	0.08
142	0.08
143	0.08
144	0.08
145	0.1
146	0.1
147	0.1
148	0.11
149	0.09
150	0.1
151	0.11
152	0.11
153	0.09
154	0.09
155	0.1
156	0.14
157	0.17
158	0.19
159	0.21
160	0.22
161	0.26
162	0.32
163	0.37
164	0.42
165	0.5
166	0.58
167	0.67
168	0.76
169	0.76
170	0.78
171	0.76
172	0.75
173	0.73
174	0.72
175	0.69
176	0.67
177	0.67
178	0.63
179	0.6
180	0.56
181	0.49
182	0.46
183	0.42
184	0.36
185	0.32
186	0.27
187	0.24
188	0.22
189	0.21
190	0.15
191	0.11
192	0.09
193	0.1
194	0.11
195	0.11
196	0.1
197	0.09
198	0.09
199	0.1
200	0.1
201	0.08
202	0.08
203	0.08
204	0.09
205	0.13
206	0.14
207	0.16
208	0.2
209	0.26
210	0.3
211	0.37
212	0.39
213	0.44
214	0.51
215	0.55
216	0.59
217	0.6
218	0.62
219	0.66
220	0.69
221	0.63
222	0.59
223	0.53
224	0.49
225	0.45
226	0.44
227	0.4
228	0.39
229	0.41
230	0.41
231	0.41
232	0.39
233	0.35
234	0.31
235	0.24
236	0.18
237	0.14
238	0.1
239	0.08
240	0.08
241	0.1
242	0.09
243	0.09
244	0.09
245	0.08
246	0.12
247	0.13
248	0.17
249	0.16
250	0.18
251	0.22
252	0.28
253	0.32
254	0.37
255	0.44
256	0.43
257	0.51
258	0.5
259	0.5
260	0.49
261	0.47
262	0.48
263	0.44
264	0.41
265	0.37
266	0.39
267	0.37
268	0.39
269	0.39
270	0.35
271	0.39
272	0.48
273	0.47
274	0.52
275	0.53
276	0.49
277	0.49
278	0.49
279	0.43
280	0.4
281	0.41
282	0.4
283	0.41
284	0.45
285	0.44
286	0.49
287	0.51
288	0.48
289	0.47
290	0.44
291	0.43
292	0.38
293	0.35
294	0.27
295	0.22
296	0.21
297	0.14
298	0.11
299	0.07
300	0.06
301	0.07
302	0.06
303	0.06
304	0.05
305	0.06
306	0.07
307	0.08
308	0.07
309	0.08
310	0.09
311	0.09
312	0.09
313	0.08
314	0.08
315	0.08
316	0.1
317	0.09
318	0.1
319	0.14
320	0.21
321	0.26
322	0.26
323	0.31
324	0.37
325	0.43
326	0.43
327	0.42
328	0.37
329	0.34
330	0.34
331	0.29
332	0.24
333	0.18
334	0.18
335	0.15
336	0.14
337	0.12
338	0.11
339	0.11
340	0.11
341	0.12
342	0.14
343	0.18
344	0.2
345	0.22
346	0.27
347	0.29
348	0.28
349	0.34
350	0.34
351	0.33
352	0.3
353	0.29
354	0.24
355	0.22
356	0.24
357	0.18
358	0.19
359	0.19
360	0.22
361	0.25
362	0.28
363	0.28
364	0.28
365	0.33
366	0.33
367	0.36
368	0.39
369	0.37
370	0.39
371	0.41
372	0.39
373	0.35
374	0.34
375	0.31
376	0.26
377	0.25
378	0.23
379	0.21
380	0.23
381	0.2
382	0.19
383	0.17
384	0.16
385	0.17
386	0.16
387	0.16
388	0.15
389	0.21
390	0.21
391	0.28
392	0.31
393	0.28
394	0.28
395	0.28
396	0.26
397	0.19
398	0.19
399	0.11
400	0.09
401	0.09
402	0.08
403	0.06
404	0.06
405	0.06
406	0.05
407	0.05
408	0.04
409	0.05
410	0.06
411	0.07
412	0.12
413	0.16
414	0.23
415	0.25
416	0.26
417	0.31
418	0.36
419	0.4
420	0.41
421	0.39
422	0.41
423	0.48
424	0.54
425	0.5
426	0.47
427	0.44
428	0.43
429	0.44
430	0.4
431	0.36
432	0.37
433	0.39
434	0.44
435	0.44
436	0.4
437	0.41
438	0.39
439	0.4
440	0.42
441	0.43
442	0.42
443	0.48
444	0.52
445	0.5
446	0.5
447	0.44
448	0.36
449	0.31
450	0.25
451	0.19
452	0.15
453	0.14
454	0.1
455	0.1
456	0.09
457	0.1
458	0.11
459	0.12
460	0.16
461	0.19
462	0.23
463	0.27
464	0.31
465	0.31
466	0.3
467	0.3
468	0.26
469	0.26
470	0.25
471	0.24
472	0.27
473	0.27
474	0.28
475	0.28
476	0.28
477	0.29
478	0.26
479	0.26
480	0.23
481	0.23
482	0.22
483	0.2
484	0.21
485	0.16
486	0.15
487	0.12
488	0.08
489	0.06
490	0.05
491	0.05
492	0.04
493	0.05
494	0.05
495	0.06
496	0.08
497	0.09
498	0.1
499	0.11
500	0.14
501	0.15
502	0.17
503	0.19
504	0.18
505	0.22
506	0.22
507	0.23
508	0.21
509	0.23
510	0.24
511	0.23
512	0.22
513	0.19
514	0.18
515	0.21
516	0.21
517	0.18
518	0.2
519	0.19
520	0.19
521	0.17
522	0.17
523	0.13
524	0.11
525	0.11
526	0.06
527	0.07
528	0.06
529	0.06
530	0.06
531	0.06
532	0.05
533	0.05
534	0.05
535	0.07
536	0.08
537	0.09
538	0.15
539	0.19

A0A2P7YTS3

3D AlphaFold-predicted Structure Viewer