Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P7YT36

Protein Details
Accession A0A2P7YT36    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
97-117HEKPKNKEKADKPKKDKNGSABasic
NLS Segment(s)
PositionSequence
99-113KPKNKEKADKPKKDK
Subcellular Location(s) nucl 15.5, cyto_nucl 12.333, mito_nucl 9.666, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR020428  PFA-DSPs  
IPR029021  Prot-tyrosine_phosphatase-like  
IPR004861  Siw14-like  
Gene Ontology GO:0016791  F:phosphatase activity  
Pfam View protein in Pfam  
PF03162  Y_phosphatase2  
Amino Acid Sequences MSQEKSSAEVTRTGSPSLESSRDQTKDSQNGAQQEAQEEDQVLMRTTITPRPNYVPPLNFSLVEDGIYRSGFPMPINYPFMQQLKLKTIIYVGDLSHEKPKNKEKADKPKKDKNGSAAIYEKYKAWIDSTDIKFCPLLVHSSQEPFTLLETQIQTQESLEAALHLILDKRNFPILIHSNKGKHRIGVLVGLMRKILQGWCMSGIFEEYEKFAMGKSEFDLEFIEMWQPELSYEEEWLPGFVRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.29
4 0.29
5 0.29
6 0.24
7 0.26
8 0.33
9 0.34
10 0.35
11 0.37
12 0.41
13 0.45
14 0.47
15 0.49
16 0.45
17 0.48
18 0.49
19 0.45
20 0.38
21 0.32
22 0.31
23 0.26
24 0.22
25 0.19
26 0.15
27 0.16
28 0.15
29 0.14
30 0.11
31 0.11
32 0.12
33 0.14
34 0.21
35 0.23
36 0.24
37 0.27
38 0.32
39 0.35
40 0.4
41 0.43
42 0.4
43 0.38
44 0.42
45 0.4
46 0.36
47 0.32
48 0.29
49 0.23
50 0.2
51 0.18
52 0.13
53 0.12
54 0.12
55 0.11
56 0.08
57 0.09
58 0.09
59 0.09
60 0.12
61 0.13
62 0.17
63 0.21
64 0.21
65 0.21
66 0.24
67 0.25
68 0.24
69 0.24
70 0.23
71 0.24
72 0.26
73 0.25
74 0.21
75 0.21
76 0.18
77 0.18
78 0.16
79 0.11
80 0.11
81 0.12
82 0.13
83 0.2
84 0.24
85 0.24
86 0.28
87 0.37
88 0.42
89 0.47
90 0.55
91 0.56
92 0.64
93 0.74
94 0.79
95 0.79
96 0.8
97 0.84
98 0.81
99 0.74
100 0.68
101 0.66
102 0.56
103 0.51
104 0.44
105 0.36
106 0.31
107 0.28
108 0.23
109 0.16
110 0.15
111 0.13
112 0.11
113 0.1
114 0.12
115 0.2
116 0.23
117 0.24
118 0.24
119 0.24
120 0.23
121 0.22
122 0.2
123 0.12
124 0.13
125 0.1
126 0.13
127 0.13
128 0.15
129 0.16
130 0.15
131 0.15
132 0.12
133 0.12
134 0.11
135 0.11
136 0.12
137 0.13
138 0.13
139 0.14
140 0.14
141 0.13
142 0.11
143 0.11
144 0.08
145 0.08
146 0.07
147 0.05
148 0.05
149 0.05
150 0.05
151 0.05
152 0.06
153 0.07
154 0.09
155 0.1
156 0.11
157 0.13
158 0.13
159 0.13
160 0.2
161 0.25
162 0.29
163 0.33
164 0.36
165 0.4
166 0.44
167 0.51
168 0.44
169 0.38
170 0.35
171 0.34
172 0.31
173 0.28
174 0.26
175 0.24
176 0.23
177 0.22
178 0.2
179 0.17
180 0.16
181 0.14
182 0.13
183 0.1
184 0.11
185 0.12
186 0.14
187 0.15
188 0.15
189 0.13
190 0.14
191 0.12
192 0.12
193 0.11
194 0.1
195 0.1
196 0.11
197 0.1
198 0.1
199 0.13
200 0.13
201 0.13
202 0.14
203 0.18
204 0.17
205 0.18
206 0.19
207 0.16
208 0.16
209 0.15
210 0.17
211 0.12
212 0.14
213 0.13
214 0.12
215 0.11
216 0.12
217 0.14
218 0.12
219 0.13
220 0.13
221 0.14
222 0.14
223 0.15